KEGG   Mus musculus (house mouse): 215748
Entry
215748            CDS       T01002                                 
Symbol
Cnksr3, 6820402C05, BC024086, Magi1
Name
(RefSeq) Cnksr family member 3
  KO
K23784  connector enhancer of kinase suppressor of Ras 3
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    215748 (Cnksr3)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 PDZ domain-containing proteins
  Other PDZ domain-containing proteins
   215748 (Cnksr3)
SSDB
Motif
Pfam: CNK2_3_dom CRIC_ras_sig SAM_1 SAM_2 PDZ PDZ_6 PDZ_2 SAM_PNT Peptidase_M50
Other DBs
NCBI-GeneID: 215748
NCBI-ProteinID: NP_766134
MGI: 2674130
Ensembl: ENSMUSG00000015202
UniProt: Q8BMA3
Position
10:complement(7069061..7162237)
AA seq 555 aa
MEPVTKWSPKQVVDWTRGLDDCLQPYVHKFEREKIDGEQLLKISHQDLEELGVTRIGHQE
LVLEAVDLLCALNYGLETDTMKNLVLKLRASSHNLQNYISSRRKSPAYDGNTSRKPPNEF
LTSVVELIGAAKALLAWLDRAPFTGITDLSVTKNKIIQLCLDLTTAVQKDCLIAEMEDKV
LNVVKVLNGICDKTMRSTTDPVMSQCACLEEVHLPNVRPGEGLGMYIKSTYDGLHVITGT
TENSPADRSQKIHAGDEVIQVNRQTVVGWQLKNLVRKLRENPTGVVLLLKKRPTGSFSFT
PAPLKNLRWKPPLVQTSPPPTTTQSPESTMDASLKKEKPAILDLYIPPPPAVPYSPRDEN
VSFGYRGHSKSKQPLPVRKGSESPNSFLDQESQRRRFTIADSDQLPGYSVETNVLPTKMR
GKTPSYGKPRPLSMPADGNWMGIVDPFAKPRGNGRKGEDALCRYFSNERITPITEESASP
MYRFSRPLTERHLVRGADYIRGSRCYINSDLHSSATIPFQEEGSKKKSASSSAKASSGEP
SLLVSWLTRLKLLTH
NT seq 1668 nt   +upstreamnt  +downstreamnt
atggagcccgtgaccaagtggagccccaaacaagtggtggactggactagagggttggat
gactgcctgcagccatatgtgcacaagtttgagcgggagaagatagacggggagcagttg
ctgaaaatctcccaccaggatctcgaggaactgggggtcacacggatcggccaccaagag
ctggtgttggaggctgtggatcttctctgtgcactgaattatggccttgaaactgatact
atgaagaacttggttctgaaactgcgggcatcttcccacaacttgcagaattacatcagt
agccgccggaagagtccagcctacgatgggaatacgtcccgtaagccccccaacgagttc
ctgacttctgtggtggaactcattggtgctgccaaggccctgctggcttggctggaccgg
gctccattcacagggatcacagatctctctgtgacaaagaacaaaatcatccaactgtgc
ctggacctgaccacagcagtccagaaggattgcctcatagcagaaatggaggataaagtt
ttaaatgtggtcaaggttttaaatggcatctgtgacaaaacaatgcgctctactacagac
cctgttatgagccagtgtgcctgcctggaggaagttcacttaccaaatgttagacccggg
gaaggcctgggcatgtacatcaagtcaacctacgacggactgcatgtgattactggaacc
acagaaaattctcctgcagacagatctcaaaagattcacgctggcgatgaggtcattcaa
gtcaatcggcagacagtggttgggtggcagttgaaaaatctggtgagaaagttgagagag
aaccccacgggcgtggtgctgctgctgaagaagaggcccacgggctccttcagcttcact
ccggccccactgaagaacctgcggtggaagccaccgctcgtgcagacctcacccccgccc
accaccacccagtccccagagagtaccatggatgcctccctgaagaaggagaagccagcc
atcctggatctatacatccctcccccacctgctgtcccctactctccccgggatgagaat
gtgagtttcggctacagaggacacagtaagagtaagcagccgttgcctgtgcgcaagggt
tccgagtcccctaactccttcctggaccaggagagccaaagacgcagatttaccattgca
gattccgatcagctgcccgggtattcggtggaaaccaatgttctgcccacaaaaatgaga
gggaagacaccatcctacggcaaaccccggcctctgtccatgcctgccgatgggaactgg
atggggatcgtggacccttttgctaaacctcgaggaaatgggaggaaaggggaagatgcc
ctctgccggtacttcagcaatgagcggatcacacccatcactgaagaaagtgcctctcct
atgtaccggttctctagacccctgactgagcggcacctggtccgaggtgcggactacatc
cgagggagcaggtgctacatcaactccgacctacacagcagtgccaccattccattccag
gaggaaggttccaagaagaaatcagcctcctcatcggccaaggcgtcctctggggagccg
tcgctgctggtcagctggctgactcgcctcaagctgttgactcactga

DBGET integrated database retrieval system