KEGG   Mus musculus (mouse): 215798
Entry
215798            CDS       T01002                                 

Symbol
Adgrg6, 1190004A11Rik, AI449247, AW045736, DREG, Gm222, Gpr126
Name
(RefSeq) adhesion G protein-coupled receptor G6
  KO
K08463  adhesion G-protein coupled receptor G6
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    215798 (Adgrg6)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    215798 (Adgrg6)
Peptidases and inhibitors [BR:mmu01002]
 Mixed peptidases
  Family P2
   215798 (Adgrg6)
G protein-coupled receptors [BR:mmu04030]
 Adhesion receptor family
  Others
   215798 (Adgrg6)
SSDB
Motif
Pfam: 7tm_2 CUB GPS CUB_2
Other DBs
NCBI-GeneID: 215798
NCBI-ProteinID: NP_001002268
MGI: 1916151
Ensembl: ENSMUSG00000039116
Vega: OTTMUSG00000059618
UniProt: Q6F3F9
Position
10:complement(14278327..14421467)
AA seq 1165 aa
MMFDTLGKRCCPWRLKPSALLFLFVLCVTCVPLSVCGCGSCRLVLSNPSGTFTSPCYPND
YPNTQSCSWTLRAPAGYIIQITFNDFDIEEAPNCIYDSLSLDNGESQTKFCGATAKGLSF
NSSVNEMHVSFSSDFSIQKKGFNASYIRVAVSLRNQKVILPQTLDAYQVSVAKSISIPEL
KAFTLCFEASKVGNEGGDWTAFSYSDESLTQLLSLEKASNGYFLSISGSRCLLNNALPVK
DKEDIFTENLEQLCLVWNNSWGSIGINFKKNYETVPCDSTISAVVPGDGTLLLGSDRDEV
ASLRGSIYNFRLWNFTMDLKALSNLSCSVSGNVIDWHNDFWSISTQALKAEGNLSCGSYL
IQLPAAELTNCSELGTLCQDGIMYRISVVIHNDFNHPEVKVQTKVAEWLNSTFQNWNYTV
YVVNISFHQKVGEDRMKVKRDIMDDDKRLVLWALLVYNATNNVSLNEEKIKQKLMTNNAS
LEDGLRLCEVDVNQLGMCSALEDPDGFSWPATLPSVYKQPCPNKPGFFMTRACLSNGTST
FWGPVDTSNCSRQSNEVANEILNQTGDGQNLTSANINSIVEKVKRIVNKEENIDITLGST
LMNIFSNILSSSDSDLLESSTEALKTIDELAFKIDLNSTPHVNIETQNLALGVSSLIPGT
NAPSNFSIGLPSNNESYFQMDFGNGQTDPLASVILPPNLLENLSPEDSVLVRRAQFTFFN
KTGLFQDVGSQRKVLVSYVMACSIGNITIQNLKDPVQIKIKHTRTQEVHHPICAFWDMNK
NKSFGGWNTSGCVAHSDLDAGETICLCSHFTHFGVLMDLPRSASQIDGRNTKVLTFITYI
GCGISAIFSAATLLTYVAFEKLRRDYPSKILMNLSSALLFLNLIFLLDGWVTSFGVAGLC
TAVAALLHFFLLATFTWMGLEAIHMYIALVKVFNTYIHRYILKFCIIGWGLPALVVSIIL
VSRRQNEVYGKESYGKDQDDEFCWIQDPVVFYVSCAGYFGVMFFLNVAMFIVVMVQICGR
NGKRSNRTLREEVLRNLRSVVSLTFLLGMTWGFAFFAWGPLNIPFMYLFSIFNSLQGLFI
FIFHCAMKENVQKQWRRHLCCGRFRLADNSDWSKTATNIIKKSSDNLGKSLSSSSIGSNS
TYLTSKSKSSSTTYFKRNSHSDNFS
NT seq 3498 nt   +upstreamnt  +downstreamnt
atgatgtttgacactctcgggaagaggtgctgcccttggagactgaagccaagcgccctg
ctgttcctgtttgttttatgtgttacctgtgttcctctctcagtgtgcggatgtggcagc
tgcagacttgtcctgtccaatccttccggtacctttacgtctccgtgttaccctaatgac
taccctaatacccagtcttgttcgtggaccctccgagcccctgccggctacatcattcag
ataacgttcaatgacttcgacattgaagaagctcccaactgtatctatgactcattgtcc
ctcgataatggagagagccagacaaaattctgtggagcgactgccaagggcctgtcattt
aactccagcgtgaatgagatgcatgtgtccttttcaagtgactttagtatccagaagaaa
ggtttcaacgccagctacatcagagttgctgtgtccttgaggaatcaaaaggtcattttg
ccccagacattagatgcttaccaggtatcagttgcaaaaagcatctccattcctgaactc
aaagctttcacgctctgttttgaagcctccaaagttggcaatgaaggtggtgactggaca
gctttctcctactcagacgagtcccttacacagctgctcagtcttgaaaaggccagtaat
ggctacttcctgtccatctctggctcaagatgcttgttgaacaatgcgttacctgtgaag
gacaaagaggacatcttcacagaaaacttggagcagctctgtcttgtgtggaataattct
tggggctccattggtataaatttcaaaaagaactatgaaacagttccatgtgattccacc
atcagtgctgtcgtacccggggatgggacattgctgttgggctccgacagagatgaggtc
gcctctctaaggggcagcatctataactttcgactttggaattttaccatggatctgaaa
gccctctccaacctcagctgtagtgtgtctgggaatgtcatagactggcacaatgacttt
tggagcatctcaacccaagctctgaaagccgagggcaacctgagctgtggttcctacctg
atccagcttcctgcagcagagctgacaaactgttcagaactggggactctctgtcaagac
ggaataatgtatcgaatatctgttgtgattcacaatgactttaatcaccctgaagtaaaa
gtgcagaccaaagtagcagaatggctcaattcaacctttcagaattggaactacactgtt
tatgtggttaatataagttttcatcaaaaagtaggagaggacaggatgaaagtcaagaga
gacatcatggacgatgacaaaaggttggtgctctgggcccttctagtctacaatgctacc
aataacgtcagcctgaatgaagagaagattaaacaaaagcttatgacaaataatgcatca
ctagaggatggactgaggctgtgtgaagtcgacgtgaaccagctgggtatgtgtagcgcc
ttggaggatccagacggctttagttggccagccaccttaccctctgtctacaaacaacca
tgtccaaacaagcctggcttttttatgactcgagcgtgcctttctaatggaacatcaacc
ttctggggccctgttgacacttccaactgttcaagacaatcaaatgaagtggccaatgag
attttaaaccaaactggtgatgggcagaacctcacctcggctaatatcaacagcattgta
gaaaaggtcaaacggatcgtgaacaaagaagaaaacattgacatcaccctcggctccact
ctaatgaatatattttctaatatcttaagcagttcagatagcgatttgcttgagtcttct
actgaagctttaaaaacaattgacgagctagccttcaaaatagacctgaatagcacccca
catgtgaacattgagacacagaatttggcccttggagtctcatccctaattccaggaaca
aatgcaccttcaaattttagcattggccttccaagcaataatgaatcgtacttccagatg
gacttcgggaacggacagacagatccactggcatctgtgattttgcctccaaatttgctt
gagaatttaagccccgaagattctgtattggtcaggagagcacagttcactttcttcaac
aaaaccggacttttccaggatgttggatctcaaagaaaagtcctcgtgagttatgtgatg
gcgtgcagcattggaaacattactatccagaatctgaaagatccggttcaaatcaaaatc
aaacacaccagaacacaggaagtgcatcatcctatctgtgccttctgggatatgaacaaa
aacaaaagtttcggggggtggaacacctcaggatgtgttgcccactctgatttggacgct
ggtgagaccatttgtctgtgcagccacttcactcactttggagttctgatggatcttcca
aggagtgcctcacaaatagatggaagaaacacaaaagtcctcacgttcattacctatatt
gggtgcggaatatctgccattttctcagctgcaactctcctgacatatgttgcttttgag
aagctgcgcagggattatccctccaaaatcctgatgaatctgagctcggccttgctcttc
ctgaatctcatcttcctcctggatggctgggtcacttcctttggcgtggctggactctgc
acggctgtggctgccctgttgcacttcttcctcctggctaccttcacctggatggggctg
gaagccatccacatgtacattgctcttgtgaaagtgtttaacacttacatccaccgctat
attctaaaattctgcatcataggctggggtctgccagccttggtggtgtcaattattcta
gtgagcagaagacaaaatgaagtatatggaaaagaaagttatgggaaagatcaggatgat
gaattctgctggattcaggatcctgtggtgttttatgtgagctgtgccgggtacttcgga
gtcatgttcttcctgaatgtcgccatgttcattgtggtcatggtgcagatctgtgggagg
aatggaaagagaagcaaccggaccctgagagaagaggttttaagaaacctgcgcagtgtg
gtcagcctgaccttcctgcttggcatgacgtgggggtttgctttctttgcctggggaccc
ttaaatattcctttcatgtacctcttctccatcttcaattcattacaaggtttatttata
ttcatcttccactgtgcgatgaaggagaatgttcagaaacagtggaggcgtcacctctgc
tgtggcaggtttcggctagcagacaactcagattggagtaagacagctaccaatatcatc
aagaagagctccgataacctggggaaatctttgtcttcaagctccattggctccaattca
acatatctcacatccaaatcaaagtccagctccactacctatttcaaaagaaacagccac
tcggataatttctcctaa

DBGET integrated database retrieval system