KEGG   Mus musculus (mouse): 215854
Entry
215854            CDS       T01002                                 

Gene name
Taar5, Gm227, taR-5
Definition
(RefSeq) trace amine-associated receptor 5
  KO
K05051  trace amine associated receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    215854 (Taar5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    215854 (Taar5)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Biogenic amine
   Trace amine
    215854 (Taar5)
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Other DBs
NCBI-GeneID: 215854
NCBI-ProteinID: NP_001009574
MGI: 2685073
Ensembl: ENSMUSG00000069706
Vega: OTTMUSG00000019210
UniProt: Q5QD14 B2RTA0
Position
10; 10 A4
AA seq 337 aa
MRAVLLPGSGEQPTAFCYQVNGSCPRTVHPLAIQVVIYLACAVGVLITVLGNLFVVFAVS
YFKVLHTPTNFLLLSLALADMLLGLLVLPLSTVRSVESCWFFGDFLCRLHTYLDTLFCLT
SIFHLCFISIDRHCAICDPLLYPSKFTVRTALRYIVAGWGIPAAYTAFFLYTDVVERALS
QWLEEMPCVGSCQLLFNKFWGWLNFPAFFVPCLIMISLYLKIFVVATRQAQQIRTLSQSL
AGAVKRERKAAKTLGIAVGIYLVCWLPFTVDTLVDSLLNFITPPLVFDIFIWFAYFNSAC
NPIIYVFSYRWFRKALKLLLSREIFSPRTPTVDLYHD
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgagagctgtcctcctcccgggctctggagagcagcctacagcgttctgctaccaggtg
aatgggtcttgccccaggacagtccacccgctggccatccaggtcgtcatctatctggcc
tgcgcagtgggtgtgctgatcacagtcctggggaatttgtttgtggtgtttgcagtgtcc
tactttaaagtgctccacacgcccaccaacttcctgctgctctccctggccctggcagac
atgttgctaggtctgctggtgctgcccctgagcacagtccgctctgtggagagctgctgg
ttctttggagacttcctgtgccgtctgcatacctatctggacacgctgttctgtctcacc
tccatcttccatctctgttttatttccattgaccgtcattgtgccatctgtgaccccctg
ctctatccctccaagttcacagtcaggacagccctccgctacatcgtggcagggtggggg
ataccagcagcctacactgccttcttcctctacacagatgtggtagagagagcactcagc
cagtggctagaagagatgccttgtgtgggcagctgccagctgctgttcaataagttctgg
ggttggttaaacttccctgcattttttgttccctgcctaatcatgatcagcttgtacctg
aagatctttgtggtcgccaccaggcaggctcagcagatcagaactctgagccaaagcttg
gctggggctgtcaagcgggaaagaaaagctgccaagacgctgggcattgctgtgggcatc
taccttgtgtgttggcttcccttcactgttgacacactagtggacagccttcttaacttc
atcaccccacccctggtctttgacatctttatctggtttgcttatttcaattcagcctgt
aatcccatcatctacgtcttctcctaccggtggtttaggaaggcactgaaactgctcctg
agccgggagatcttctcaccaaggacaccgactgttgatttataccatgactga

DBGET integrated database retrieval system