KEGG   Mus musculus (house mouse): 215951
Entry
215951            CDS       T01002                                 
Symbol
Afg1l, CG8520, Lace1
Name
(RefSeq) AFG1 like ATPase
  KO
K18798  peroxisome-assembly ATPase [EC:3.6.4.7]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    215951 (Afg1l)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.7  peroxisome-assembly ATPase
     215951 (Afg1l)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    215951 (Afg1l)
SSDB
Motif
Pfam: AFG1_ATPase AAA AAA_16 Bac_DnaA UvrD-helicase AAA_22 SLFN-g3_helicase POR
Other DBs
NCBI-GeneID: 215951
NCBI-ProteinID: NP_665686
MGI: 2148801
Ensembl: ENSMUSG00000038302
UniProt: Q3V384
Position
10:complement(42188577..42354561)
AA seq 480 aa
MAASWSPLVTLRSAARSRLTGRGVGCGARVVAIPPPAPGPGKPLWKAYTVQTSEGVRPTA
ASEARLKALAVCHGPLDHYDFLIKSQELREDEHQRRVVQCLQKLQEDLKGYSIEEGGLFS
KLFSRNKPPKGLYVYGDVGTGKTMVMDMFYAYVETKRKKRVHFHGFMLDVHRRIHHLKQS
LPKRKAGFMAKSYDPIAPIAEEISQETSLLCFDEFQVTDIADAMILKQLFENLFKNGVVV
VATSNRPPEDLYKNGLQRANFVPFIAVLKEYCDTLQLDSGVDYRKRELAPAGKLYYLTSE
ADVEAVVDKLFDELAQKQNDLTSPRILKVQGRELRLNKACGSVADCTFEELCERPLGASD
YLELSKNFDTVIIRNIPQFSLAKRTQARRFITLIDNFYDFKVRIICSASAPISSLFLHQH
QDSESDQSRILMDDLGLSQDSAGLSMFTGEEEIFAFQRTISRLTEMQTEQYWIEGDRSRK
NT seq 1443 nt   +upstreamnt  +downstreamnt
atggcggcctcctggtcgcccttggttactctgcgctccgccgcgcgcagccggctgact
gggagaggtgttgggtgcggggcgcgggtcgtcgcaatccctcctccggcccctggccct
gggaaacccctgtggaaagcctacacagtccagacatccgagggtgtacgcccaacagcc
gcttctgaggcccgtttgaaagccttggctgtttgccacgggcctctggaccactacgac
tttctgatcaaatctcaggagctgagggaggatgaacatcaaagaagagtcgttcagtgt
ttgcagaagttacaggaggaccttaaaggatacagcatagaggaaggagggctcttttca
aagcttttttcaaggaacaaacctccaaagggcctctatgtttatggagacgttggtaca
ggaaaaacaatggtgatggacatgttttatgcatatgtggaaacgaagagaaagaagcgg
gtccattttcacggcttcatgctggacgtgcacagaaggatacaccaccttaaacagagt
ttgccaaaaaggaaggcgggattcatggctaagtcatatgacccgatagctcccatagcc
gaggaaatcagtcaagaaacttctctcctatgttttgatgaatttcaggtcactgacatc
gccgacgccatgattctgaaacagctttttgaaaatctgttcaaaaacggggtcgtcgtt
gtggcaacatccaacagaccaccggaagatctctataaaaatggactccagagggctaac
tttgtgccatttatagctgtcctgaaggaatattgtgatacgctccagctggattctggg
gtagattaccggaaaagggaactcgcccctgcaggaaaactctactacctcacaagtgag
gctgatgtggaggccgtcgtggataagttgtttgatgagctggctcagaaacaaaatgat
ttaactagcccaaggattctgaaagtgcaaggcagagagctgcggctgaataaagcctgt
ggaagcgttgccgactgcacatttgaagagctgtgtgagagaccacttggagcaagtgac
tatttggaattatcaaagaattttgatacggtaatcatacgaaacattccgcagttttca
ctggcaaagaggacgcaagcgagaagattcatcactctcattgataacttctatgacttc
aaggtgcgcattatctgctccgcttcagctccgatctcaagcttgtttctgcatcagcat
caggacagtgagtcggaccaaagcagaatcctgatggatgatttggggctgagccaggac
tcagccgggctctccatgtttacgggggaggaggaaatcttcgcctttcagcgcaccatt
tcccggctcacagagatgcagacggagcagtactggattgaaggggacagaagcaggaag
taa

DBGET integrated database retrieval system