KEGG   Mus musculus (mouse): 215999
Entry
215999            CDS       T01002                                 

Gene name
Mcu, 2010012O16Rik, AV064928, C10orf42, Ccdc109, Ccdc109a, D130073L02Rik, Gm64
Definition
(RefSeq) mitochondrial calcium uniporter
  KO
K20858  calcium uniporter protein, mitochondrial
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04218  Cellular senescence
mmu04621  NOD-like receptor signaling pathway
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    215999 (Mcu)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    215999 (Mcu)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    215999 (Mcu)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    215999 (Mcu)
   05012 Parkinson disease
    215999 (Mcu)
   05014 Amyotrophic lateral sclerosis
    215999 (Mcu)
   05017 Spinocerebellar ataxia
    215999 (Mcu)
   05020 Prion disease
    215999 (Mcu)
   05022 Pathways of neurodegeneration - multiple diseases
    215999 (Mcu)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    215999 (Mcu)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    215999 (Mcu)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial protein import machinery
  Inner mambrane
   Mitochondrial calcium uniporter complex
    215999 (Mcu)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   215999 (Mcu)
SSDB
Motif
Pfam: MCU SPX Optomotor-blind
Other DBs
NCBI-GeneID: 215999
NCBI-ProteinID: NP_001028431
MGI: 3026965
Ensembl: ENSMUSG00000009647
Vega: OTTMUSG00000034290
UniProt: Q3UMR5
Position
10; 10 B4
AA seq 350 aa
MAAAAGRSLLLLLCSRGGGGGAGGCGALTAGCFPGLGVSRHRPHQQHRTAHQRPASWQSV
GAAYCSTVVPSDDVTVVYQNGLPVISVRLPSRRERCQFTLKPISDSVGVFLRQLQEEDRG
IDRVAIYSPDGVRVAASTGIDLLLLDDFKLVINDLTYHVRPPKRDLLSHEDAATLNDVKT
LVQQLYTTLCIEQHQLNKERELVERLEDLKQQLAPLEKVRIEISRKAEKRTTLVLWGGLA
YMATQFGILARLTWWEYSWDIMEPVTYFITYGSAMAMYAYFVMTRQEYVYPEARDRQYLL
FFHKGAKKSRFDLEKYNQLKDAIAQAEMDLKRLRDPLQVHLPLRQIGEKE
NT seq 1053 nt   +upstreamnt  +downstreamnt
atggcggccgccgcaggtagatcgctcctgctgctgctctgctcccggggcggcggcggg
ggcgccggcggctgcggagcgctgactgccggctgctttcccgggctgggcgtcagccgc
caccggccgcaccagcagcaccggacggcacaccagaggccggcttcctggcagagcgtg
ggagccgcatattgcagtacggttgtgccctctgatgacgtgacggtggtttaccaaaat
ggattaccggtgatatctgtgaggctaccctctcgacgcgagcgctgccaattcacactc
aagcctatctctgactcagtcggcgtgtttttacgacaactgcaagaggaggatcgggga
atcgaccgggtcgccatctactcaccagatggcgttcgagtcgctgcctccacggggata
gacctcctgctcctcgatgactttaagcttgtcattaatgacttaacataccacgtacgg
ccaccaaagagagacctcctaagccatgaagatgcagcgacgctgaacgacgtgaagacc
ctggtccagcagctgtacaccacactgtgcattgagcagcatcagcttaacaaagagcgg
gagctcgtggagaggttagaggacctcaagcagcagctggcccccctggagaaggtacga
attgaaattagcagaaaagcagagaagaggaccactctggtgctgtggggaggcctggcc
tacatggccacccagtttggcattctggcccggctcacctggtgggagtactcgtgggac
atcatggagcccgtcacctacttcatcacgtacggaagcgccatggccatgtatgcgtat
tttgtaatgacgcgccaggaatatgtttatccagaagccagagacagacaatacttatta
tttttccataaaggagccaaaaagtcacgtttcgacctagagaaatacaatcagctcaag
gatgcaattgctcaggcagaaatggatcttaagagactgagagacccattacaagtacac
ctgcccctccgacagatcggagaaaaggaatga

DBGET integrated database retrieval system