KEGG   Mus musculus (house mouse): 216019
Entry
216019            CDS       T01002                                 
Symbol
Hkdc1, BC016235
Name
(RefSeq) hexokinase domain containing 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00051  Fructose and mannose metabolism
mmu00052  Galactose metabolism
mmu00500  Starch and sucrose metabolism
mmu00520  Amino sugar and nucleotide sugar metabolism
mmu00524  Neomycin, kanamycin and gentamicin biosynthesis
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu01250  Biosynthesis of nucleotide sugars
mmu04066  HIF-1 signaling pathway
mmu04910  Insulin signaling pathway
mmu04930  Type II diabetes mellitus
mmu04973  Carbohydrate digestion and absorption
mmu05230  Central carbon metabolism in cancer
Module
mmu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mmu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
mmu_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    216019 (Hkdc1)
   00051 Fructose and mannose metabolism
    216019 (Hkdc1)
   00052 Galactose metabolism
    216019 (Hkdc1)
   00500 Starch and sucrose metabolism
    216019 (Hkdc1)
   00520 Amino sugar and nucleotide sugar metabolism
    216019 (Hkdc1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    216019 (Hkdc1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    216019 (Hkdc1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    216019 (Hkdc1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    216019 (Hkdc1)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    216019 (Hkdc1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    216019 (Hkdc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    216019 (Hkdc1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     216019 (Hkdc1)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    216019 (Hkdc1)
SSDB
Motif
Pfam: Hexokinase_2 Hexokinase_1 VPS13_mid_rpt CSD
Other DBs
NCBI-GeneID: 216019
NCBI-ProteinID: NP_663394
MGI: 2384910
Ensembl: ENSMUSG00000020080
UniProt: Q91W97
Position
10:complement(62218916..62259490)
AA seq 915 aa
MFAVHLVAFYFTKLKEDQIKKVDRFLYHMRLSDETLVDIMARFQAEMEKGLGKDTNPTAS
VKMLPTFVRAIPDGSENGEFLSLDLGGSKFRVLKVQVSQEGQQNVQMESQFYPMPNEITR
GNGTELFDYVADCLADFMKTKNLTHKKLPLGFTFSFPCRQNKLEEGVLLSWTKKFKARGV
QDTDVVNRLATAMKKHKDLDVDILALVNDTVGTMMTCAYDDPNCEVGVIIGTGTNACYME
DMSNIDLVEGDEGRMCINTEWGAFGDDGALEDIRTEFDRELDLGSLNPGKQLFEKMISGL
YMGELVRLILLKMAKVGLLFGGAKSSALHTKGKIETQHVAAMEMSKEGLANTREILVDLG
LEPSESDCIAVQHVCTIVSFRSANLCAAALATILTRLRENKKLARLRTTVGMDGTLYKTH
PQYPKRLHKVVRRLVPNCDVRFLLSESGSTKGAAMVTAVASRVQAQRKQIDKVLALFQLT
REQLLGVRDKMRAELEYGLKKKTHSLATVKMLPTYVYGMPDGTEKGKFLALDLGGTNFRV
LLVKIRRRSVRMYNKIFAIPLEIMQGTGEELFDHIVQCIADFLDYMGLKGAQLPLGFTFS
FPCRQTCIDKGTLVGWTKGFKATDCEGEDVVDMLREAIKRRNEFDLDIVAIVNDTVGTMM
TCGYEDPRCEIGLIAGTGSNVCYMEEMRNIELVDGDEGRMCVNTEWGGFGDNGCIDDIRT
QYDKEVDEGSLNAGKQRYEKMTSGMYLGEIVRRILIDLTRQGLLFRGQISERLRTRGIFE
TKFLSQIESDRLALLQVRRILQQLGLDSTCEDSIVVKEVCGAVSRRAAQMCGAGMAAIVE
KRREDQGLQHFKVTVGVDGTLYKLHPHFSRILQETVKELAPQCDVTFMLSEDGSGKGAAL
ITAVAKRLQQPRKDI
NT seq 2748 nt   +upstreamnt  +downstreamnt
atgtttgcagtacacttggtggcgttttacttcaccaagctgaaggaggaccagatcaag
aaggtggacaggttcctgtatcacatgcggctctcggatgagaccctggtggacatcatg
gcccgcttccaggccgagatggagaaaggcttggggaaggacaccaaccccactgcctct
gtgaagatgctgcccacattcgtcagggccattccagatggctcagaaaacggggaattc
ctttccctggatctcggaggatccaagtttcgggtcttgaaggtgcaagtctcccaagag
ggccagcaaaatgttcagatggagagccagttctacccaatgcccaatgaaatcacccgt
gggaatggcacggagctttttgactacgtagccgactgcctggcagatttcatgaagacc
aaaaatctgacacataagaagctgcctctgggcttcaccttttcttttccctgcagacag
aataagttggaggagggtgttctgctttcgtggaccaagaagttcaaggcccggggagtt
caggacacagacgtggtgaaccgcctggccactgccatgaagaagcacaaggacctggac
gtggacatcctggctttggttaacgacactgtggggaccatgatgacttgtgcttatgat
gatcccaactgtgaagtcggcgttatcatcggaacaggcaccaacgcgtgttacatggag
gacatgagcaacatcgacctcgtggaaggggacgagggaaggatgtgtatcaacacggag
tggggggcctttggggacgatggggctttggaggacatccgcaccgagtttgacagagag
ctggacctgggctcgctcaaccccgggaagcagctgttcgagaagatgatcagcgggctg
tacatgggggagctggtcaggcttatcttgctgaagatggccaaagttggtctcctgttt
gggggtgcaaaatcctctgctctccatacaaagggcaagatcgaaacacagcacgtggct
gccatggagatgagtaaagaaggcctggccaacactcgagagatcctggtggatttgggc
ctggagccctctgagtcagactgcatcgctgtccagcacgtgtgcaccatcgtctctttt
cgctcagccaatctctgcgcagcggctctggcaaccatcctgactcgactccgagagaac
aagaagctggcccggctccgcaccacagtgggcatggatggaactctctacaaaacacac
cctcagtaccccaaacgcctacacaaggtggtgaggagactggtcccaaactgtgatgtc
cgcttcctcctgtcagagagtggaagcaccaagggggccgccatggtgaccgcagtggcc
tctcgggtacaggcccagcgcaagcagatcgacaaggtgctggctttgttccagttgacc
cgagagcaactcctgggtgtgcgggacaagatgcgggctgaactagagtacgggctgaag
aaaaagacccactctctggctaccgtgaagatgcttcccacctatgtctatgggatgccg
gatggcacagagaaaggaaagttccttgccctggatttggggggaaccaacttccgagtc
ctcctggtaaagatcaggcggaggtctgtgcgcatgtacaacaagatcttcgccatccct
ctggagatcatgcagggcactggggaggagctctttgaccacatcgtacagtgcatcgct
gacttcctggactacatgggcctcaagggcgcccagctgcctttgggcttcaccttctcc
ttcccctgcagacagacatgcatcgacaaggggactctagtagggtggaccaaaggcttc
aaggccaccgactgtgaaggggaggacgtggtggacatgctcagagaagccatcaagagg
agaaacgagtttgacctggacattgttgcaatcgtgaacgacacagtggggaccatgatg
acctgtggctatgaagatcccaggtgtgagattggcttgattgcagggacaggaagcaac
gtgtgctacatggaggaaatgaggaacatcgagctggtggatggggacgaaggccggatg
tgcgtcaacacggagtggggcgggtttggtgacaatggctgcatcgatgacatccgcacc
cagtatgacaaggaggtggatgagggctccctgaacgccggcaagcagagatacgagaaa
atgaccagtggaatgtacctgggggagattgtgaggcggatcctgatcgacctcacccgg
caggggctcctcttccgagggcagatttcagagcgactccggaccaggggcatctttgaa
accaaattcctgtcccagattgaaagtgaccggctggccctcctgcaggtcaggaggatc
ctgcagcagctgggcctggacagcacgtgcgaagacagtattgtggtgaaggaggtgtgt
ggggctgtgtctcggagggccgcccagatgtgtggtgccggcatggctgccatcgtggag
aagaggagagaagaccaaggcctccagcacttcaaggtcaccgtgggcgtggatggcaca
ctgtacaagctgcacccgcacttctcccggatactgcaggagacggtgaaagagctggcc
cctcagtgtgatgtgacatttatgttgtcagaagacggcagcgggaagggagcagctctg
atcacagctgtagccaagaggttacagcagccacggaaggacatctag

DBGET integrated database retrieval system