KEGG   Mus musculus (mouse): 216028Help
Entry
216028            CDS       T01002                                 

Gene name
Lrrtm3, 9630044H04Rik
Definition
(RefSeq) leucine rich repeat transmembrane neuronal 3
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_5 LRR_4 LRR_9 LRRNT EphA2_TM LapA_dom
Motif
Other DBs
NCBI-GeneID: 216028
NCBI-ProteinID: NP_848793
MGI: 2389177
Ensembl: ENSMUSG00000042846
Vega: OTTMUSG00000023795
UniProt: Q8BZ81
Position
10; 10 B4
AA seq 582 aa AA seqDB search
MGFNVIRLLRGSAVAVVLAPTVLLTMLSSAERGCPKGCRCEGKMVYCESQKLQEIPSSIS
AGCLGLSLRYNSLQKLKYNQFKGLNQLTWLYLDHNHISNIDENAFNGIRRLKELILSSNR
ISYFLNNTFRPVTNLRNLDLSYNQLHSLGSEQFRGLRKLLSLHLRSNSLRTIPVRIFQDC
RNLELLDLGYNRIRSLARNVFAGMIRLKELHLEHNQFSKLNLALFPRLVSLQNLYMQWNK
ISVIGQTMSWTWSSLQRLDLSGNEIEAFSGPSVFQCVPNLQRLNLDSNKLTFIGQEILDS
WISLNDISLAGNIWECSRNICSLVNWLRSFKGLRENTIICASPKELQGVNVIDAVKNYSI
CGKSTTTERFDLARALPKPTFKPKLPRPKHESKPPLPPTVGATEPSPETDVDTEHISFHK
IIAGSVALFLSVLVILLVMYVSWKRYPASMKQLQQRSLMRRHRKKKRQSLKQMTPGTQEF
YVDYKPTNTETSEMLLNGTGPCTYSKSGSRECEIPLSMNVSTFLAYDQPTISYCGVHHEL
LSHKSFETNAQEDTMESHLETELDLSTITSAGRISDHKPQLA
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgggtttcaatgtaattaggctactgcgaggatcagctgtagcggtggttctagcaccc
actgtcttactgacaatgctttcttctgctgaacgaggatgccctaagggttgtaggtgt
gaaggcaaaatggtatactgtgagtctcagaaactgcaggagataccctcgagtatatct
gccggttgcttgggtttatcccttcgctacaacagcctccaaaaacttaagtataatcaa
tttaaagggctcaatcagctcacctggctctaccttgaccacaaccacatcagcaatatc
gacgagaatgctttcaatgggatacgcagactcaaagagttgattctgagttccaacaga
atctcctatttccttaacaacaccttcagacctgtgaccaatttacggaacttggatctg
tcctacaatcagctccattctctgggatcggaacagttccggggcttgaggaagctgctt
agtttacacctccgctccaactcactgagaaccatcccggtgcggatcttccaagactgt
cgcaacctggaacttctggacctgggatacaaccggatccgaagtttagccaggaatgtc
tttgctggcatgatcagactcaaagagcttcacctggagcacaatcaattttccaagctc
aacctggccctgttcccaaggctggtgagccttcagaacttgtacatgcagtggaataaa
atcagtgtcatagggcaaaccatgtcctggacctggagttccttacagaggctcgacctg
tctggtaatgagatcgaagccttcagcggacccagtgtcttccagtgtgttcccaatctg
caacgcctcaacctggattccaacaagctcacatttattggacaagagattctggattct
tggatctctctcaatgacatcagtctggctgggaatatatgggaatgcagcaggaatatc
tgttccctggtaaactggctgagaagttttaaaggtctgagagagaatacaatcatctgc
gccagtcccaaagagctgcagggggttaacgtgatcgatgcggtgaagaactacagcatc
tgtgggaagagcactaccacagagaggtttgacctggccagggccctccccaagcccaca
tttaagcccaagctccccaggccgaagcacgagagcaagcctcctctgccccccacggtg
ggagctaccgagcccagcccagagacagatgtggacacggagcacatctccttccataag
atcatcgcgggcagcgtggcccttttcctgtcggtgctggtcatcctcctggtgatgtac
gtgtcctggaagcggtaccccgcgagcatgaagcagctgcagcagcgctccctcatgcga
aggcaccggaagaagaaacggcaatcgctcaagcagatgactccaggcacccaggaattt
tatgtagattataaacccaccaacacggagaccagcgagatgctgctgaacggaacggga
ccctgcacctatagcaaatcaggctccagggaatgtgagatacctttatcaatgaatgtg
tcaacctttctggcatatgaccagcccacaataagttactgtggggtccatcatgaactc
ctctcccataagtcctttgaaacgaatgcacaggaagacacgatggaaagccacctagag
actgagctggacttgagcacaatcacgtcagctggccgcatcagtgaccataaaccacag
ctggcctga

DBGET integrated database retrieval system