KEGG   Mus musculus (mouse): 216080
Entry
216080            CDS       T01002                                 

Gene name
Ube2d1, UBCH5
Definition
(RefSeq) ubiquitin-conjugating enzyme E2D 1
  KO
K06689  ubiquitin-conjugating enzyme E2 D [EC:2.3.2.23]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    216080 (Ube2d1)
   04120 Ubiquitin mediated proteolysis
    216080 (Ube2d1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    216080 (Ube2d1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     216080 (Ube2d1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   216080 (Ube2d1)
SSDB
Motif
Pfam: UQ_con RWD Prok-E2_B UEV
Other DBs
NCBI-GeneID: 216080
NCBI-ProteinID: NP_663395
MGI: 2384911
Ensembl: ENSMUSG00000019927
Vega: OTTMUSG00000031044
UniProt: P61080 Q3UFQ4
Position
10; 10 B5.3
AA seq 147 aa
MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDY
PFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLV
PDIAQIYKSDKEKYNRHAREWTQKYAM
NT seq 444 nt   +upstreamnt  +downstreamnt
atggcgctgaagcggatccagaaagaattaagtgatttacagcgtgatccacctgcccac
tgctcagcgggacccgtgggagatgacttgttccactggcaagcaaccatcatggggccc
cctgacagcgcctatcaaggtggagtcttcttcctcactgtccactttccgacagactat
ccctttaaaccaccaaagattgctttcacaacaaaaatctaccacccaaatataaacagc
aacgggagtatttgtcttgacatcctgaggtcccagtggtcgcccgctttgactgtatcg
aaagtcttgctgtccatatgctcgctgctctgtgatcctaatccagacgatcccttagta
ccagatattgcacagatctataaatcagacaaagaaaaatacaacaggcacgcaagagaa
tggactcagaaatatgcaatgtaa

KEGG   Mus musculus (mouse): 237009
Entry
237009            CDS       T01002                                 

Gene name
Ube2dnl1, Ube2d, Ube2dnl
Definition
(RefSeq) ubiquitin-conjugating enzyme E2D N-terminal like 1
  KO
K06689  ubiquitin-conjugating enzyme E2 D [EC:2.3.2.23]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    237009 (Ube2dnl1)
   04120 Ubiquitin mediated proteolysis
    237009 (Ube2dnl1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    237009 (Ube2dnl1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     237009 (Ube2dnl1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   237009 (Ube2dnl1)
SSDB
Motif
Pfam: UQ_con RWD
Other DBs
NCBI-GeneID: 237009
NCBI-ProteinID: NP_001263325
MGI: 3646570
Ensembl: ENSMUSG00000050435
Vega: OTTMUSG00000018431
UniProt: A2AFH1
Position
X E1; X
AA seq 155 aa
MVQPSLGAMALKRIQKELVAFSQDPPAHCSAGPVAENMFHWQATIMGPEDSPYQGGVFFL
SIHFPNNYPFKPPKVSFITRIYHPNISKNGSICLDILNSKWSPTLTISKVLLSICSLLCD
PNADDPLVPEIAKVYHKDLREYNRLAREWTERFAM
NT seq 468 nt   +upstreamnt  +downstreamnt
atggttcaacctagtttgggggcaatggctcttaagcgaatccagaaggagttagttgcc
ttctctcaagatcccccggctcactgttctgcagggccagtggcagaaaatatgtttcat
tggcaagcaaccataatggggcctgaagacagcccctaccagggaggggtttttttcctg
tccatccactttccgaacaattaccccttcaagccccccaaagtttcgttcataacccga
atttaccatccaaacattagcaaaaatggaagtatctgtctagatatcttgaattctaag
tggtcacctacacttacaatttccaaagttcttctttccatctgctctttattatgtgat
ccaaacgcagatgaccctctggttcctgaaattgctaaagtctaccacaaggatttaaga
gagtataatagattggctcgagagtggactgagagatttgcaatgtaa

KEGG   Mus musculus (mouse): 56550
Entry
56550             CDS       T01002                                 

Gene name
Ube2d2a, 1500034D03Rik, Ubc2e, Ube2d2, ubc4
Definition
(RefSeq) ubiquitin-conjugating enzyme E2D 2A
  KO
K06689  ubiquitin-conjugating enzyme E2 D [EC:2.3.2.23]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    56550 (Ube2d2a)
   04120 Ubiquitin mediated proteolysis
    56550 (Ube2d2a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    56550 (Ube2d2a)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     56550 (Ube2d2a)
Ubiquitin system [BR:mmu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   56550 (Ube2d2a)
SSDB
Motif
Pfam: UQ_con RWD Prok-E2_B UEV
Other DBs
NCBI-GeneID: 56550
NCBI-ProteinID: NP_064296
MGI: 1930715
Ensembl: ENSMUSG00000091896
UniProt: P62838 Q3UT95
Position
18; 18 B2
AA seq 147 aa
MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDY
PFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLV
PEIARIYKTDREKYNRIAREWTQKYAM
NT seq 444 nt   +upstreamnt  +downstreamnt
atggctctgaagagaatccacaaggaattgaatgacctggctcgagatcccccagcacag
tgttcagcaggtcctgttggagatgatatgtttcattggcaggctacaataatggggcca
aatgacagcccctatcagggtggagtatttttcttgacaattcatttcccaacagattac
cccttcaaaccgcctaaggttgcatttacaacaagaatttatcacccaaatattaacagt
aatggcagcatttgtcttgatattctacggtcacagtggtctccagcactaactatttca
aaagtacttttgtccatctgttctctgttgtgtgatcccaatccagatgatcctttagtg
cctgagattgctcggatctacaaaacagatagagaaaagtacaacagaatagctcgggaa
tggactcagaagtatgcgatgtaa

KEGG   Mus musculus (mouse): 66105
Entry
66105             CDS       T01002                                 

Gene name
Ube2d3, 1100001F19Rik, 9430029A22Rik, AA414951
Definition
(RefSeq) ubiquitin-conjugating enzyme E2D 3
  KO
K06689  ubiquitin-conjugating enzyme E2 D [EC:2.3.2.23]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    66105 (Ube2d3)
   04120 Ubiquitin mediated proteolysis
    66105 (Ube2d3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    66105 (Ube2d3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     66105 (Ube2d3)
Ubiquitin system [BR:mmu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   66105 (Ube2d3)
SSDB
Motif
Pfam: UQ_con RWD Prok-E2_B UEV
Other DBs
NCBI-GeneID: 66105
NCBI-ProteinID: NP_079632
MGI: 1913355
Ensembl: ENSMUSG00000078578
Vega: OTTMUSG00000054825
UniProt: P61079 Q4QQL2
Position
3; 3 G3
AA seq 147 aa
MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDY
PFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLV
PEIARIYKTDRDKYNRISREWTQKYAM
NT seq 444 nt   +upstreamnt  +downstreamnt
atggcgctgaaacggattaataaggaacttagtgatttggcccgtgaccctccagcacaa
tgttctgcaggtccagttggagatgacatgtttcattggcaagccacaattatgggacct
aatgacagcccatatcaaggtggtgtattctttttgacaattcattttcctacagactac
cccttcaaaccacctaaggttgcatttacaacaagaatttatcatccaaatattaacagt
aatggcagcatttgtcttgatattctaagatcacagtggtctcctgctttaactatttct
aaagttcttttatccatttgttcactgctatgtgatccaaacccagacgaccccctagtg
ccagagattgcacggatctataaaacagacagagataagtacaacagaatatctcgggaa
tggactcagaagtatgccatgtga

KEGG   Mus musculus (mouse): 73318
Entry
73318             CDS       T01002                                 

Gene name
Ube2d2b, 1700013N18Rik
Definition
(RefSeq) ubiquitin-conjugating enzyme E2D 2B
  KO
K06689  ubiquitin-conjugating enzyme E2 D [EC:2.3.2.23]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    73318 (Ube2d2b)
   04120 Ubiquitin mediated proteolysis
    73318 (Ube2d2b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    73318 (Ube2d2b)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     73318 (Ube2d2b)
Ubiquitin system [BR:mmu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   73318 (Ube2d2b)
SSDB
Motif
Pfam: UQ_con RWD Prok-E2_B UEV
Other DBs
NCBI-GeneID: 73318
NCBI-ProteinID: NP_001263326
MGI: 1920568
Ensembl: ENSMUSG00000063447
Vega: OTTMUSG00000023561
UniProt: Q6ZWY6
Position
5; 5 F
AA seq 147 aa
MALKRIHKELNDLAQDPPAQCSAGPVGEDMFHWQATIMGPNDSPYQGGAFFLTIDFPTEY
PFKPPKVEFTTRIYHPNVNSNGSICLDILRSQWSPALTISKVLLSISSLLCDPNPDDPLV
PEIAQIYKTDRDKYNRTAREWTQKYAM
NT seq 444 nt   +upstreamnt  +downstreamnt
atggctctgaagagaatccacaaggaactgaacgacctggcccaggatcccccagcacag
tgttcagcaggtcctgtcggggaagatatgtttcactggcaagctacaatcatggggcca
aatgatagtccctatcagggcggagcatttttcttgacaattgatttcccaacagagtac
cccttcaaaccacctaaggttgaatttacaacaagaatttatcatccaaatgttaacagt
aacggcagtatttgtcttgatattcttcggtcacagtggtctccagcactaactatttcc
aaagtacttttgtccatcagttctctgttgtgtgaccccaatccagatgatcccttagtg
cctgagattgctcagatctacaaaacagatagagacaagtacaacagaacagctcgggaa
tggactcagaaatatgcgatgtga

KEGG   Mus musculus (mouse): 75097
Entry
75097             CDS       T01002                                 

Gene name
Ube2dnl2, 4930524E20Rik
Definition
(RefSeq) ubiquitin-conjugating enzyme E2D N-terminal like 2
  KO
K06689  ubiquitin-conjugating enzyme E2 D [EC:2.3.2.23]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    75097 (Ube2dnl2)
   04120 Ubiquitin mediated proteolysis
    75097 (Ube2dnl2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    75097 (Ube2dnl2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     75097 (Ube2dnl2)
Ubiquitin system [BR:mmu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   75097 (Ube2dnl2)
SSDB
Motif
Pfam: UQ_con RWD
Other DBs
NCBI-GeneID: 75097
NCBI-ProteinID: NP_001075130
MGI: 1922347
Ensembl: ENSMUSG00000047079
Vega: OTTMUSG00000018419
UniProt: A2AFH2
Position
X; X E1
AA seq 155 aa
MDQSTLGAMALKRIQKELVAISQDPPAHCSAGPVAENMFHWQATIMGPEDSPYQGGVFFL
SVHFPNNYPFKPPKVTFITRVYHPNISKNGSICLDILNSMWSPALTISKLLLSICSLLCD
PNPDDPLVPEIAKVYRKDLREYNRLAREWTKRYAM
NT seq 468 nt   +upstreamnt  +downstreamnt
atggatcaatctactttgggggctatggctcttaagcgaatccagaaggagttagttgcc
atctctcaagatcccccggctcactgttctgcagggccagtggcagaaaatatgtttcat
tggcaagcaaccataatggggcctgaagacagcccctaccagggaggggtttttttcctg
tccgtccactttccgaacaattaccccttcaagccccccaaagttacgttcataacccga
gtttaccatccaaacattagcaaaaatggaagtatctgtctagatatcttgaattctatg
tggtcacctgcactcacaatttccaaacttcttctctctatctgctctctattatgtgat
ccaaacccagatgaccctctggtccctgaaattgcaaaggtctaccgcaaggatttaaga
gagtacaatagactggctcgagagtggaccaagagatatgcaatgtaa

DBGET integrated database retrieval system