KEGG   Mus musculus (house mouse): 216134
Entry
216134            CDS       T01002                                 
Symbol
Pdxk, 2310036D04Rik
Name
(RefSeq) pyridoxal (pyridoxine, vitamin B6) kinase
  KO
K00868  pyridoxine kinase [EC:2.7.1.35]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00750  Vitamin B6 metabolism
mmu01100  Metabolic pathways
mmu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    216134 (Pdxk)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.35  pyridoxal kinase
     216134 (Pdxk)
SSDB
Motif
Pfam: Phos_pyr_kin PfkB HpcH_HpaI BofC_C
Other DBs
NCBI-GeneID: 216134
NCBI-ProteinID: NP_742146
MGI: 1351869
Ensembl: ENSMUSG00000032788
UniProt: Q8K183
Structure
Position
10:complement(78272581..78300782)
AA seq 312 aa
MEGECRVLSIQSHVVRGYVGNRAAMFPLQVLGFEVDAVNSVQFSNHTGYAHWKGQVLKSQ
ELHELYEGLKVNDVNKYDYVLTGYTRDKSFLAMVVDIVRELKQQNSRLVYVCDPVMGDKW
NGEGSMYVPQDLLPVYRDKVVPVADIITPNQFEAELLSGRKIHSQEEAFEVMDMLHCMGP
DTVVITSSDLPSSQGSDYLIALGSQRMRKPDGSTVTQRIRMEMRKVEAVFVGTGDLFAAM
LLAWTHKHPDNLKVACEKTVSAMQHVLQRTIRCAKAEAGEGQKPSPAQLELRMVQSKRDI
EDPEIVVQATVL
NT seq 939 nt   +upstreamnt  +downstreamnt
atggagggcgaatgccgggtgctctccatccagagccatgttgtccgtggctacgtgggt
aacagagcggccatgttccctctgcaggttttgggatttgaggttgatgccgtgaactct
gtgcagttttcaaaccacacaggctacgcccattggaagggccaggtgctgaagtcccag
gaacttcatgagctgtacgagggtctcaaggtgaacgatgtcaataagtatgactacgtg
ctcactggttacacgagagacaagtctttcctggccatggtggtggacattgtgcgggag
ctgaagcaacagaactctcgccttgtgtatgtgtgtgaccctgtgatgggcgacaagtgg
aatggggaaggctccatgtacgttccccaggacctcctccccgtgtacagggacaaagtg
gtacccgtggctgacatcatcactcccaaccagtttgaggctgagttgctgagtggcaga
aaaatccacagccaagaagaagccttcgaggtgatggacatgctgcactgtatgggtccc
gacactgtggtcatcaccagctctgacctgccctcctcacagggcagcgactacctgatc
gcgctgggtagccagaggatgcggaaacctgacggctccacggtgacccagcgcatccgg
atggagatgcgcaaagtggaagctgtcttcgtgggcaccggggacctcttcgctgccatg
cttctggcgtggacacacaagcacccggacaatctcaaggtggcctgtgagaaaaccgtg
tctgccatgcagcacgtcctacagaggaccatccggtgtgcaaaagctgaagcaggagaa
ggacagaagcccagccccgctcagctggagctgaggatggtccagagcaaaagggacatc
gaggaccccgagatcgtcgtgcaggccacagtgctgtga

DBGET integrated database retrieval system