KEGG   Mus musculus (house mouse): 216136
Entry
216136            CDS       T01002                                 
Symbol
Ilvbl, 5830463I21, AI415009
Name
(RefSeq) ilvB (bacterial acetolactate synthase)-like
  KO
K11259  2-hydroxyacyl-CoA lyase [EC:4.1.2.-]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    216136 (Ilvbl)
Enzymes [BR:mmu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.-
     216136 (Ilvbl)
SSDB
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M CO_dh
Other DBs
NCBI-GeneID: 216136
NCBI-ProteinID: NP_776112
MGI: 1351911
Ensembl: ENSMUSG00000032763
UniProt: Q8BU33
Position
10:78410178..78420336
AA seq 632 aa
METSAAAASAGGFFPSFLLLAFGTLVAAVLGVAHRLGLFYQLMHKVDKTSIRHGGESVAA
VLRAHGVRFVFTLVGGHISPLLVACEKLGIRVVDTRHEVTAVFAADAVARLTGTVGVAAV
TAGPGLTNTVTAVKNAQVAQSPVLLLGGAASTLLQKRGALQAIDQMSLFRPLCKFCASVR
RVRDIVPTLRTAIAAAQSGTPGPVFVELPLDVLYPYFMVEKEMIPTKLPNSLMGRVVVWY
LQNCLANLFVGAWEPRPEGPLPLDIPQASPQQVQRCVEILSRAKRPLLVLGSQALLPPTP
ANKLRAAVETLGVPCFLGGMSRGLLGRNHPLHIRQNRSAALKKADVVVLAGAVCDFRLSY
GRVLNRKSSIIIVNRNRDDLLLNSDIFWKPQEAVQGDVGSFMIKLVEGLQGQMWSSDWAE
ELRKADQQKEQTYRDKALMPVLQHLNPVWVLQQVEETLPDNALLVVDGGDFVATAAYLVQ
PRGPLRWLDPGAFGTLGVGAGFALGAKLCQPEAEVWCLFGDGAFGYSLIEFDTFVRHKVP
VIALVGNDAGWTQISREQVPRLGSDVACSLAYTDYHKAAMGLGAQGLILSRDNKDQVVKV
LREGQQLCQDGHAVVVNILIGRTDFRDGSISV
NT seq 1899 nt   +upstreamnt  +downstreamnt
atggaaacttctgcggccgctgcatctgcgggaggcttcttcccctccttcctgctcctg
gcgtttgggacgctggtggctgccgtgctgggcgtcgctcacagactggggctcttctat
cagctgatgcacaaggtggacaagacaagcatccggcatggtggagagagtgtcgcagct
gtgctccgagcccatggtgtacgctttgtcttcacattggtcggtgggcacatttcccca
ctgctggtggcctgtgagaagctgggtatccgagtggtagacacacgccacgaggtcact
gctgtctttgctgctgatgctgtggcccgcctgactgggacagtgggtgtggcagcagtg
acagccggtcctggcctcaccaacactgtgactgcagtgaagaatgcacaagtggcacag
tccccagtcctgcttttgggtggagctgccagcaccctgctgcagaaacggggcgcactt
caggccattgatcagatgtctctgttcaggccactctgcaagttttgtgcttctgtgcga
agggtacgggacattgtacctaccctgaggactgcaatagctgctgcccagtcaggcacc
ccaggtccagtgtttgtggagctgcctcttgatgtactatatccttacttcatggttgag
aaggagatgataccaaccaagttgcccaatagcctcatgggccgtgtggttgtctggtat
ttacagaactgcctggccaacctctttgttggggcttgggaacctcgtcccgagggacct
ctgcccttggatattccccaggcatctccgcagcaggtccagcgctgtgtggagatcctg
agccgggccaagaggcctctgctggtactggggagccaggccttgctgcccccgacccct
gccaacaagcttagagctgccgtggagaccctgggtgtcccctgctttctaggggggatg
tctcgggggctgctgggccgcaaccaccctctccacatccggcagaaccgcagcgctgct
ctgaagaaagcagatgttgttgtcctggcaggcgctgtgtgtgatttccgcctgtcttat
ggccgggtcctcaaccgcaagagcagcatcatcattgtcaaccggaaccgggatgatctc
ttgctcaactcggacatcttctggaagcctcaggaggctgtgcagggagatgtgggctcc
ttcatgataaaactggtggaaggccttcagggccagatgtggtcttcagattgggctgag
gagcttcggaaagctgaccagcagaaggagcagacctatcgggataaggctttaatgcct
gtattacagcacctgaacccagtatgggtgttacagcaggtggaggaaactctgcctgac
aatgcacttcttgtggttgacggaggggactttgtggccactgctgcctacttagtccag
cccagagggcctctgcgctggctcgatcctggggcctttgggactctgggagttggcgca
ggttttgcacttggggccaagctgtgtcagccggaggctgaggtttggtgcctgtttggg
gatggagcctttggctacagcctcattgagtttgacacgttcgtcagacataaggtacca
gtgatagccttggtaggaaacgatgcaggttggacccagatttctcgagagcaggtgccc
aggttgggcagtgatgtagcctgtagcctggcttacactgattatcacaaggcagccatg
ggcctgggggcccagggattgatactctcacgggacaataaggatcaagtggtcaaggta
cttcgtgaaggccagcagctgtgccaggatggtcatgcagttgtggtcaacatcctgatt
gggaggacagacttccgagatggctccatttctgtatag

DBGET integrated database retrieval system