KEGG   Mus musculus (mouse): 216154
Entry
216154            CDS       T01002                                 

Gene name
Med16, 95kD, 95kDa, A630083L04, DRIP92, Thr, Thrap5, Tra, Trap95
Definition
(RefSeq) mediator complex subunit 16
  KO
K15159  mediator of RNA polymerase II transcription subunit 16
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04919  Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    216154 (Med16)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    216154 (Med16)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Mediator complex
    Tail
     216154 (Med16)
Motif
Pfam: Med16 WD40 ANAPC4_WD40
Other DBs
NCBI-GeneID: 216154
NCBI-ProteinID: NP_001156748
MGI: 2158394
Ensembl: ENSMUSG00000013833
Vega: OTTMUSG00000035229
UniProt: E9QP84 Q3UET8
Position
10; 10 C1
AA seq 864 aa
MAASDPGRWGECGPRPPGRLGARGGQPGTVLGAVGMMDLAYVCEWEKWAKSTYCPSLPLA
CAWSCRNLIAFTTDLRNDDQDLTHMIHILDTEHPWEVHSVSSGHSEAITCLEWDQSGSRL
LSADADGQIKCWSMADHLANSWESSVGSQVEGDPIVALSWLHNGVKLALHVEKSGASSFG
EKFSRVKFSPSLTLFGGKPMEGWIAVTVSGLVTVSLLKPSGQVLTSTESLCRLRGRVALA
DIAFTGGGNIVVAAADGSSASPVKFYKVCVSVVSEKCRIDTEILPSLFMRCTTDPNRKDR
FPAITHLKFLARDMSEQVLLCASSQTSSLVECWSLRKEGLPVNNIFQQISPVVGDKQPMI
LKWRILSATNDLDRVSAVALPKLPISLTNTDLKVASDTQFYPGLGLALAFQDGSVHMVHR
LSLQTMAVFYSSAPRSLDEPALKRPRTTCPAVHFKAMQLSWTSLALVGIDNHGKLSMLRI
SPSLGHPLEPKLALQHLLFLLEYCMVTGYDWWDILLHVQPGMVQSLVERLHEEYTRQKPA
LQQVLSTRILAMKASLCKLSPCTVARVCDYHTKLFLMAITSTLKSLLRPHFLNTPDKSPG
DRLAEICAKITDVDIDKVMINLKTEEFVLDMNTLQALQQLLQWVGDFVLYLLVSLPNQGS
PLRPGHSFLRDGTSLGMLRELMVVIRIWGLLKPSCLPVYTATSDTQDSMSLLFRLLTKLW
ICCRDEGAASEPDEGLVDECCLLPSQLLVPNLDWLPASDGLVSRLQPKQPLRLRFGRAPT
LPSSTSTLQLDGLTRAPGQPKIDHLRRLHLGAYPTEECKACTRCGCVTMLKSPNKTTAVT
QWEQRWIKNCLCGGLWRRVPLSCS
NT seq 2595 nt   +upstreamnt  +downstreamnt
atggcggcgtcggatcccgggcgttggggcgagtgtggaccgcggccgccgggccgactg
ggcgcccggggcggacagccagggaccgtgctgggtgcggtgggtatgatggacctggcc
tatgtgtgcgaatgggagaagtgggccaagagcacgtactgcccgtcgctgcccctggct
tgtgcctggtcctgcaggaacctcattgccttcaccacagacctacgcaatgatgaccag
gatctgacacacatgatccatatcctagacacggaacacccctgggaagtgcactctgtc
agctctggccacagcgaggccatcacctgcctggagtgggaccagtcagggtcccggcta
ctgtctgctgatgctgatggacagatcaaatgctggagcatggctgaccacctggccaac
agctgggagagctcggtgggcagccaggtggagggggaccccatcgtggccctgtcctgg
ctgcacaacggtgtaaagctggccctgcatgtggagaagtctggtgcctctagcttcgga
gagaagttctcacgtgtgaagttctccccgtccctcacgctgttcggtggcaagccaatg
gagggttggattgcagtgacagtcagtggcctggtcactgtgtcccttctgaagcccagc
gggcaggtgctgacgtccacggagagcctgtgccggctgcgtggtagagtggcgctggct
gacatcgccttcacgggcggtgggaacattgtggtggctgctgcagatggcagcagcgcg
tcacccgtgaagttctataaggtgtgcgtcagcgtggtcagcgagaagtgccgcatcgac
acggagatcctgccctcactgtttatgcgctgcaccaccgaccccaaccgcaaagacagg
ttccccgccatcacacacctcaagttcctggcgcgagacatgtctgagcaggtgctcctg
tgtgcgtccagccagaccagcagcctggtggaatgctggtcccttcggaaagagggcctt
cctgtgaacaatatcttccagcagatctcgcctgtggttggtgacaaacagcccatgatc
ctcaagtggcgaatcctgtcggccaccaatgacctggaccgtgtatccgcggtggcactg
ccgaaactgcccatctcactcaccaacactgacctcaaggtggccagtgacacccagttc
tatccaggccttggcttagcgctggccttccaggatggcagcgtgcacatggtgcaccga
ctgtccctgcagaccatggcggtgttctacagctcagccccgcgctcgctggatgagccg
gccctaaagcgcccacgcaccacatgccctgccgtacactttaaagccatgcagctgtcc
tggacttcgctggccctcgtgggcatcgataaccatgggaagctcagcatgctgcgaatc
tctccatccctgggccacccactggagcccaagctggccctgcagcacctgcttttcctg
ctggaatactgcatggtgaccggctatgactggtgggacatcctgctacacgtgcagccc
ggcatggtgcagagcctggtggagcggctgcatgaggagtacactcgccagaagcccgcc
ctgcaacaggtcctctccactcggatcctggccatgaaggcttcactgtgcaagctgtca
ccctgcacagtggctcgtgtgtgtgactaccacaccaagctgttcctcatggccatcacg
tccaccctaaagtcgctgctgcgcccacacttcctcaacacccctgacaagagccctggg
gaccgcctggccgagatctgcgccaagatcaccgatgttgacatcgacaaagtcatgatc
aacctgaagactgaagagttcgtccttgacatgaacactttgcaggcgctgcagcagttg
ctacagtgggtgggagacttcgtgctctacctcctggtcagcctgcccaaccagggctcc
ccgctaaggccgggccacagcttcctccgagatggtacctccctgggcatgctgcgagag
ttgatggttgtcatccgaatctggggcctgctgaagcccagctgtctgcccgtctacaca
gccacctcggacacccaggacagcatgtccctgctcttccgactgctcaccaaactgtgg
atctgctgccgtgatgagggcgcagccagtgaaccagatgagggtttggtggatgaatgc
tgcctgctgcctagccagctgctggtccccaacttggactggcttcccgccagtgatggc
ctggtcagtcgcctgcagcccaaacagcccctgcgcctgcgcttcggcagagcgcccact
ctgcccagcagcacctccaccctgcagctggacggcctcaccagggcccctggccagccc
aagatcgaccacctccggaggctacacctgggcgcctaccccaccgaggagtgcaaagcc
tgcaccaggtgtggctgtgtcaccatgctgaagtctcccaacaagacaaccgctgtgaca
cagtgggaacagcggtggatcaagaattgcctgtgtggtgggctgtggcggcgagtgcct
ctcagctgttcctga

DBGET integrated database retrieval system