KEGG   Mus musculus (house mouse): 216166
Entry
216166            CDS       T01002                                 
Symbol
Plk5, 6330514A18Rik
Name
(RefSeq) polo like kinase 5
  KO
K19596  inactive serine/threonine-protein kinase PLK5
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    216166 (Plk5)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    216166 (Plk5)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr POLO_box Kinase-like Pkinase_fungal ABC1 RIO1
Other DBs
NCBI-GeneID: 216166
NCBI-ProteinID: NP_001334053
MGI: 3026984
Ensembl: ENSMUSG00000035486
UniProt: Q4FZD7
Position
10:80192293..80201323
AA seq 595 aa
MEPRSRRRRSRQLVATFLRDPGSGRVYRRGKLIGKGAFSRCYKLTDMSTSAVFALKVVPR
GGAGRLRLRGKVEREIALHSRLRHRNIVAFHAHFADRDHVYMVLEYCSRQSLAHVLKVRR
TLTEPEVRYYLRGLVSGLRYLHQQRIVHRDLKPSNFFLNKNMEVKIGDLGLAARVGPAGR
CHRVLCGTPNFQAPEVVSRNGHSCKSDIWALGCIMYTVLTGTPPFAAAPLSEMYQNIRDG
HYLEPTHLSPSARSLIARLLAPDPAERPSLDHLLQDDFFSQGFTPERLPPHSCHSPPVFA
FPPPLGRLFRKVGQLLLTQCRPPCPFTSKEASGPGEEGTEPDHMEAGNEERDPLCTEGRI
HLLTLGTPRTGLAGPKGSLALQLEVATRKLFLCLDAGPMAGQDPPGEQRPVLWAPKWVDY
SLKYGFGYQLSDGGSGVLFRDGSHMALRPQGGHVSYQPDQGTLWTFTLRDVPSPLRAKLA
VLRLFACYMQRRLREEGTVPMPATPASPDISLLSFIADSQAMVMLFSNGTVQVSLKTSQT
QLVLSGEDEDLLLTLQEPGGPAVGVSYTLDVLRSHGFTLAVHHHLRHGLHLLQSV
NT seq 1788 nt   +upstreamnt  +downstreamnt
atggagccccggtcccggcggcggcggagccgccagcttgtggccaccttcctgcgcgac
ccaggctcggggcgcgtgtaccggcgcgggaagctgatcggcaagggagccttcagccgc
tgctacaagctcacggacatgtccaccagcgctgtgttcgctcttaaggtggtgccaagg
ggcggagcggggcggctgcgcctgcgcgggaaggtggagcgtgagatcgccctgcacagc
cgcctgcgccaccgcaacatcgtggccttccacgcacactttgctgaccgcgatcacgtg
tacatggtgctggagtattgtagccgccagtccttggctcatgtgctgaaagtgcggcgg
actctgacagagcctgaagtgcgctattaccttcggggcctggtcagcggcctgcgctac
ttgcaccaacaacgcatcgtgcacagggacctgaaacccagtaatttcttccttaacaag
aacatggaggttaagataggtgacctggggctggctgcccgtgtggggcctgctggtcgc
tgccacagggtgctctgcgggactccaaacttccaggcacctgaagtggtgtcccgaaat
ggacactcgtgcaaatctgacatctgggctctgggatgcatcatgtacacggtgctgaca
ggcacgccaccctttgccgcggcacccttgtcagagatgtaccaaaacatccgtgacggc
cactacctcgagcctactcacctgtcgcccagcgcccgcagcctcattgcacggctcctg
gcaccggaccccgccgagcggcccagcctggaccacttactgcaagatgacttcttcagt
cagggcttcaccccggagcggctgcctccacattcctgccacagcccacctgtgtttgcc
tttcccccacctctgggcaggttgttccggaaggtgggccagctcctgctgacccagtgc
cggccaccttgtccctttacctcaaaagaggcctcaggccctggagaagagggcacagaa
ccagaccacatggaagccggcaacgaggaaagggatcctctctgcaccgagggccgaatc
cacctcctcacccttgggaccccgcggactggcctggcgggcccaaaagggagcttggct
ctgcagctggaagtggcaaccagaaaactgttcctctgcttggacgcaggacctatggct
ggacaggaccccccaggggagcagcggcctgttctctgggctcctaagtgggtggattac
tccctcaagtatggcttcggctaccagctgtcggatgggggcagtggggtgctgtttcgg
gatggctcccacatggccctgcgcccccaaggcggccatgtctcctaccaacctgaccaa
gggactctctggaccttcaccctgagggacgtccccagcccacttcgtgccaagctggct
gtcctgcggctctttgcctgctatatgcagcggcgtctgcgggaggaggggactgtgccc
atgcctgccacacctgcctctcctgacatctctctgctgagcttcattgctgactcccag
gctatggtcatgctgtttagcaatgggacagtgcaggtcagcctcaaaacctcccaaacc
cagctggtgctaagtggggaggacgaggacctcctgctcaccctccaggagccaggggga
cccgctgtgggcgtctcctacacactcgatgtcctgcggagccatggcttcacccttgca
gtccaccatcacctgcgccatggcctgcatctgctacagagtgtctga

DBGET integrated database retrieval system