KEGG   Mus musculus (mouse): 216188Help
Entry
216188            CDS       T01002                                 

Gene name
Aldh1l2, D330038I09Rik, mtFDH
Definition
(RefSeq) aldehyde dehydrogenase 1 family, member L2
  KO
K00289  formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00670  One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    216188 (Aldh1l2)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     216188 (Aldh1l2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh Formyl_trans_N Formyl_trans_C PP-binding DUF1487
Motif
Other DBs
NCBI-GeneID: 216188
NCBI-ProteinID: NP_705771
MGI: 2444680
Ensembl: ENSMUSG00000020256
Vega: OTTMUSG00000024804
UniProt: Q8K009
Position
10; 10 C1
AA seq 923 aa AA seqDB search
MLWRGSQALRHFSTSRVYFKNKLKLALIGQSLFGQEVYSQLLKEGHRVVGVFTVPDKDGK
ADPLALAAEKDGTPVFKFPRWRLKGKTIKEVAEAYQSVGAELNVLPFCTQFIPMDVIDSP
KHGSIIYHPSLLPRHRGASAINWTLIMGDKKAGFSVFWADDGLDTGPILLQRSCDVKPND
TVDSLYNRFLFPEGIKAMVEAVQLIADGKAPRTPQPEEGATYEGIQKKENAEVSWDQPAE
GLHNWIRGHDKVPGAWAEINGQMVTFYGSSLLTSSVPSGEPLDIRGAKKPGLVTKNGLVL
FGNDGKALMVRNLQFEDGKMIPASQYFSAGETSVVELTAEELKVAETIKVIWARILSNTP
VIEDSTDFFKSGASSMDVVRLVEEIRQSCGGLQLQNEDVYMATKFGDFIQKVVRRLRGED
EEAEMVVDYVSKEVNGMTVKIPYQCFINGQFVDAEDGETYATVNPTDGTTICRVSYASLA
DVDRAVAAAKDAFENGEWGRMNARDRGRLMYRLADLMEENQEELATIEALDSGAVYTLAL
KTHIGMSVQTFRYFAGWCDKIQGSTIPINQARPNYNLTFTKKEPLGACAIIIPWNYPLMM
LAWKSAACLAAGNTLVLKPAQVTPLTALKFAELTVKAGFPKGVINIIPGSGGVAGQRLSQ
HPDIRKLGFTGSTSVGKQIMKSCAVSNLKKVSLELGGKSPLIIFSDCDLEKAVRMGMGAV
FFNKGENCIAAGRLFVEEAIHDEFVTRVVEEIKKMKIGDPLDRSTDHGPQNHRAHLEKLL
QYCETGVQEGATLVYGGRQVQRPGFFMEPTVFTGVEDHMYLAKEESFGPIMVISKFQNGD
IDGVLQRANNTEYGLASGVFTRDINKAMYVSDKLEAGTVFINTYNKTDVAAPFGGMKQSG
FGKDLGEEALNEYLKIKTVTLEY
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgctgtggcggggtagccaggcgctacggcacttctccaccagccgggtttatttcaaa
aacaagctgaagttggcacttattggccagagcctgttcggacaggaagtctatagccag
ctcctgaaagagggccaccgagtagtgggagtgttcacagtgccagacaaggatggaaag
gccgatccactggctttggctgcagagaaagatgggactcccgtgttcaagttccctcga
tggagactcaagggtaaaaccatcaaggaggtagcagaagcttaccagtcggtgggagcc
gagctcaacgtgctccccttctgcacacagttcatccccatggatgtcattgacagccca
aagcatggctccatcatctaccacccctcactcctacccaggcacagaggagcttctgcc
atcaactggacactaatcatgggagataagaaagctgggttttctgttttctgggcagat
gatggtttggatacaggacccatccttcttcagagatcgtgtgacgtcaagcccaatgac
acagtggactcgctttataaccggttcctttttcctgaggggatcaaggccatggtagaa
gccgtccaactcatagctgatggaaaagcgcctcgcactccccagccagaagagggggca
acatatgaaggcatccagaagaaggagaacgctgaggtttcttgggaccagcctgctgaa
ggtttgcataactggattcgaggtcatgacaaggtccctggagcctgggcagagatcaat
ggacagatggtgactttctacggctcatcactgttgactagttctgtgccttctggagaa
ccactggacattagaggtgccaagaagcccggtcttgtcaccaaaaatggccttgtcctt
tttgggaatgatggaaaagcactgatggtgagaaacctgcagtttgaggacggaaagatg
attccagcctcccagtacttttctgcgggtgagacatcagtggtagaacttacggccgag
gagctgaaggtggcagagaccattaaggtcatctgggctcgaattttaagcaacacccct
gtgattgaggactccacggacttctttaaatctggagcgagctcaatggatgttgtgagg
ctggtggaagagatcagacagagttgcggagggcttcagctgcagaatgaagacgtctac
atggccaccaagtttggagatttcatccaaaaggttgtgcggagactgagaggagaggac
gaagaggcagagatggtggtggattacgtttccaaggaggtgaacgggatgacagtgaaa
atcccctaccagtgtttcataaatggacagtttgtggatgccgaggatggagagacttac
gccactgtcaaccccacagatggaactacaatatgcagagtgtcctacgcttctttagcg
gatgttgacagagcagtagccgcagccaaggacgcctttgagaacggcgaatgggggagg
atgaacgccagagacagaggaagactcatgtacagactcgctgacctaatggaagaaaac
caagaagagctggccaccatagaagcgctggattccggggctgtctacaccctggctctg
aagactcacattggaatgtctgtgcagacgttcagatacttcgcaggctggtgtgacaaa
attcagggttctacaattccaatcaaccaggcccggccgaattacaacctgaccttcacc
aagaaggagccacttggtgcctgtgccattatcattccttggaactacccactgatgatg
ctggcctggaagagcgcagcgtgcctggcggcaggcaacaccctggtgctcaagcctgca
caggtcacacccttgacggctctgaagtttgcagagctgaccgtgaaagctggctttccc
aagggggtgattaacatcattccaggctcagggggtgtcgcaggacagaggctctctcag
caccctgacatccgcaagcttggcttcactggatccacctcagtgggcaaacagatcatg
aaaagctgtgctgtgagcaacctgaagaaagtttcccttgagcttggtggcaaatcccca
ctgataatattcagtgattgtgaccttgaaaaggctgtacggatgggcatgggcgcagtg
tttttcaataaaggagagaactgcattgcagctgggcggctgtttgtggaagaggccatc
cacgacgaattcgtaaccagagtggtggaagagattaaaaagatgaaaattggagatccc
ctggacagatctacggaccatgggccccagaaccacagagcgcacttggaaaagctgctg
cagtactgtgagactggggtgcaggagggggccacactggtgtatggaggaagacaggtg
cagaggccaggcttcttcatggaacccactgtgttcacaggcgtggaagatcacatgtac
cttgccaaggaggaatcctttgggcctatcatggtcatttctaaattccaaaatggggac
atcgatggggtgttgcagagagcaaataacactgaatatggcttggcctcaggggtcttc
acaagagacatcaacaaagccatgtatgtgagtgacaagctagaggcgggaacggttttc
attaacacctacaacaagacagacgtggcagccccatttggtggaatgaagcaatctggc
tttggaaaagacttaggtgaggaggccctgaatgaatacctgaaaatcaaaacagtgaca
ctcgagtattag

DBGET integrated database retrieval system