KEGG   Mus musculus (mouse): 216190Help
Entry
216190            CDS       T01002                                 

Gene name
Appl2, DIP13_beta, Dip3_beta, Dip3b
Definition
(RefSeq) adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 2
  KO
K20132  DCC-interacting protein 13-beta
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    216190 (Appl2)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    216190 (Appl2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BAR_3 PH PID PTB PH_17 PH_9 PH_2 DUF3263
Motif
Other DBs
NCBI-GeneID: 216190
NCBI-ProteinID: NP_660255
MGI: 2384914
Ensembl: ENSMUSG00000020263
Vega: OTTMUSG00000027828
UniProt: Q8K3G9 Q3TVI6
Position
10; 10 C1
AA seq 662 aa AA seqDB search
MPAVDKLLLEEALQDSPQARSLLSVFEEDAGTLTDYTNQLLQAMQRVYGAQNEMCLATQQ
LSRQLLAYEKQNFALGKGDEEVISTLHYFSKVMDELNGLHTELAKQLADTMVLPVIQFRE
KDLTEVSTLKDLFGLASSEHDLSMAKYSRLPKKKENEKAKTEIVKEVAAARRKQHLSSLQ
YYCALNALQYRKRAAMMEPLIGFAHGQINFFKRGAEMFSKSMDGFLSSVKDMVQSIQVEL
EAEADKMRVSQQELLSVSESVYTPDIDVATAQINRNLIQKTGYLNLRNKTGLVTTTWERL
YFFTQGGNLMCQPRGAVAGGLIQDLDNCSVMAVDCEDRRYCFQISTPSGKPGIILQAESR
KEYEEWICAVNNISRQIYLTDNPEAVAIKLNQTALQAVTPITSFGKKQESSCSSQNIKNS
DIEDDNIVPKATASIPETEELIAPGTPIQFDIVLPATEFLDQNRGGRRTNPFGETEDGSF
PEAEDSLLQQMFIVRFLGSMAVKTDSTAEVIYEAMRQVLAARAIHNIFRMTESHLMVTSQ
TLRLIDPQTQVSRACFELTSVTQFAAHQENKRLVGFVIRVPESTGEESLSTYIFESNSEG
EKICYAINLGKEIIEVQKDPEALARLMLSVPLTNDGKYVLLNDQADDTGGSPSENRGAES
EA
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccgtggacaagctcctgctggaggaggcgctgcaggacagcccccaggcgcgc
tccttgctgagtgtatttgaagaagatgctggcaccctcacagattacaccaaccagctg
ctgcaggccatgcagcgtgtctatggcgcacagaatgaaatgtgcctggccactcagcag
ctttccaggcagctgctggcatatgaaaaacagaattttgcactgggcaaaggcgatgaa
gaagtaatttcaacactacattatttttccaaagtgatggatgagctcaatggtctccac
acagagctggccaagcaactggcagacactatggttctccctgttatacagtttcgagag
aaggatctcacagaagtcagcactttgaaggatctctttggacttgccagcagcgagcac
gacctgtcaatggcaaagtatagcaggctccctaagaagaaggagaacgagaaggcgaag
acggaaattgtgaaagaggtggcggctgcccggcggaaacagcacctctcatcccttcag
tactactgcgcactcaacgcactgcagtaccgcaagcgggcggccatgatggaacccttg
ataggctttgcccacggacagatcaactttttcaagagaggagcagagatgttctccaaa
agtatggacggcttcttgtcatccgttaaagacatggttcagagcattcaggtggaactg
gaagctgaggcagacaagatgcgggtgtcccagcaagagttgctttcggtcagtgaatct
gtttacactccggacattgatgtggccacagcgcagatcaacaggaacctcatccagaag
actggttacctcaatctcagaaacaagaccggactggtcaccaccacgtgggagaggctg
tacttcttcacccaaggcgggaacctcatgtgccagccccggggcgctgtggctggaggc
ttgattcaggacctggacaactgctctgtgatggccgtggattgtgaagaccgacgatac
tgcttccagatctccacgcccagtggcaaaccgggaataattctccaagcagagagcagg
aaggaatatgaagagtggatatgtgcagtaaacaacatctccaggcagatctacctgacg
gacaacccagaggcagtagccatcaagttgaatcagacggctcttcaggcggtgacgcca
attacaagctttgggaagaaacaagaaagctcctgctccagtcaaaacataaaaaattca
gacatagaagatgacaatattgttcccaaagcaacagccagcattcctgaaacagaggaa
ctgattgcacctgggacacccattcagtttgatattgtacttccggcaacagaattcctt
gaccagaacaggggtggcaggcgcaccaaccctttcggtgagacggaggatggctcattc
cctgaagcagaagactctcttctgcagcagatgttcatcgttcggtttttgggatcaatg
gcagttaagacagacagcacggctgaagtgatttatgaggcaatgagacaagtactggct
gctcgagctattcacaacatcttccgcatgaccgaatcccatctcatggtcaccagtcaa
actctgaggttgatagatcctcagactcaagtgtcaagggcctgttttgagcttaccagt
gtcacacagtttgctgctcatcaagaaaacaaaagactggttggctttgtcatccgggtg
ccggagtccacaggagaagagtctctgagcacatacatttttgaaagcaactcagaagga
gaaaagatatgctatgctattaatttggggaaagaaattattgaggttcaaaaggatcca
gaagcactggctcgattaatgctgtctgtaccactaaccaatgatggaaagtatgtactg
ttaaacgatcaagcagatgacactggcggaagtccaagtgaaaacagaggcgcagaatct
gaagcataa

DBGET integrated database retrieval system