KEGG   Mus musculus (mouse): 216197
Entry
216197            CDS       T01002                                 

Gene name
Ckap4, 5630400A09Rik, CLIMP, CLIMP-63, P6, P63
Definition
(RefSeq) cytoskeleton-associated protein 4
  KO
K13999  cytoskeleton-associated protein 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    216197 (Ckap4)
SSDB
Motif
Pfam: EzrA Crescentin Fez1 NPV_P10 Lebercilin DUF812 Baculo_PEP_C DUF1664 FliJ Syntaxin-6_N TRAF_BIRC3_bd CP12 DUF2730 Bacillus_HBL COG2 TMPIT FPP
Other DBs
NCBI-GeneID: 216197
NCBI-ProteinID: NP_780660
MGI: 2444926
Ensembl: ENSMUSG00000046841
Vega: OTTMUSG00000063492
UniProt: Q8BMK4
Position
10; 10 C1
AA seq 575 aa
MPSAKQRGSKGGHGAASPSDKGAHPSGGADDVAKKPPAAPQQPQPPAPHPPQHPQNQAHR
GGHRGRSSAATANASSASCSRRLGRVLNFLFYLSLVAAAAFSGWYVHHVLEEVQQVRRGH
QDFSRQRDELGQGLQGVEQKVQSLQATFGTFESLLRNSQHKQDLTEKAVKEGESELNRIS
EVLQKLQNEILKDLSDGIHVVKDARERDFTSLENTVEERLTELTKSINDNIAIFTDVQKR
SQKEINEVKMKVASLEESKGDRSQDVKTLKDAVKEVQASMMSRERDIEALKSSLQTMESD
VYTEVRELVSLKQEQQAFKQAADSERLALQALTEKLLRSEESSSRLPEDIRRLEEELQQL
KVGAHGSEEGAVFKDSKALEELQRQIEGLGARLQYVEDGVYSMQVASARHTESLESLLSK
SQEYEQRLAMLQEHVGNLGSSSDLASTVRSLGETQLALSSDLKELKQSLGELPGTVESLQ
EQVLSLLSQDQAQAEGLPPQDFLDRLSSLDNLKSSVSQVESDLKMLRTAVDSLVAYSVKI
ETNENNLESAKGLLDDLRNDLDRLFLKVEKIHEKI
NT seq 1728 nt   +upstreamnt  +downstreamnt
atgccctcggccaaacaaaggggctccaagggcggccacggcgccgcgagcccctcggac
aagggcgcccacccgtcgggcggcgcggatgacgtggcgaagaagccgccggcggcgccg
cagcagccgcagcctcccgcgccgcacccgccgcagcacccgcagaaccaggcgcaccgg
ggcggccaccgcggccggtcctcagccgccaccgccaacgcgtcctccgcgtcctgctcg
cgcaggcttggccgggtgctcaactttctcttctacctctccctggtggcggcggccgcc
ttctcgggctggtatgtccatcacgtcctggaggaggtccagcaggtccggcgtggccac
caggacttctcccgtcagagggatgagctgggccagggcttgcagggcgtcgagcagaag
gtccaatccctgcaagccacatttgggactttcgagtccctcctgagaaactcccagcat
aaacaggatctcacagagaaagccgtgaaggaaggggagagcgagctcaaccgaattagc
gaagttctacagaagttgcagaatgagattctcaaagatctgtcggacgggatccacgtg
gtgaaggatgcccgggagcgggacttcacgtccctggagaacacagtcgaggagcgcctg
acggagcttaccaagtctatcaatgacaacatcgccatcttcactgatgtccagaagagg
agccagaaggagatcaatgaggtcaagatgaaggtggcctccctggaagaatccaagggg
gatcgcagtcaggacgtgaaaactctgaaggacgccgtgaaggaggtccaggcctccatg
atgtcgagggagagggacattgaggccctgaagagttcccttcagacgatggagtccgac
gtctacacagaggtgcgggaactggtgagcctcaagcaggagcaacaggcgttcaagcag
gcggccgactcagagcgcctggctctgcaggccctcacggagaagcttctgcggtccgag
gagtcctcctctcgtctcccagaggacatccggagactggaggaagagctacagcagctg
aaggtcggggcccatgggtcagaggaaggtgccgtcttcaaagactccaaagccttagag
gaactgcagaggcagattgagggcctgggtgccaggctccagtatgtagaggacggggtc
tactcaatgcaggtggcttctgcacgccacaccgaaagcctggagtcgctcctgtccaag
agccaggagtacgagcaacgcctggctatgctgcaggagcacgtgggaaacctgggctcc
tcatctgacctggccagcacagtcaggagcctgggggagacccagctggcgctgtccagc
gacttgaaggagctgaagcagagcctgggtgagctgcccggtaccgtggagtcactgcag
gagcaagtgctctcactgctcagccaggaccaagcccaggccgagggcttgcctcctcag
gacttcctggacagactgtcctctctagacaacctgaaatcctcagtgagccaagtggag
tcagacttgaaaatgctcaggactgccgtggacagtttggtggcctattccgtcaaaatc
gaaacgaatgagaataacttagagtcagccaagggcttgctggatgacctgcggaacgac
ctggataggttgtttctgaaagttgagaagatccatgaaaagatctaa

DBGET integrated database retrieval system