KEGG   Mus musculus (house mouse): 216198
Entry
216198            CDS       T01002                                 
Symbol
Tcp11l2, E430026E19Rik
Name
(RefSeq) t-complex 11 (mouse) like 2
  KO
K25628  T-complex protein 11
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    216198 (Tcp11l2)
Cilium and associated proteins [BR:mmu03037]
 Motile cilia and associated proteins
  Sperm flagellum proteins
   216198 (Tcp11l2)
SSDB
Motif
Pfam: Tcp11 PDT
Other DBs
NCBI-GeneID: 216198
NCBI-ProteinID: NP_666120
MGI: 2444679
Ensembl: ENSMUSG00000020034
UniProt: Q8K1H7
Position
10:84412811..84450219
AA seq 517 aa
MPFNGEKQCVSEDQQSDSESSRFAEGVASLSDYECSRQSFTSDSSSKSSSPASTSPPRGL
MFDDVMAAAKNLSDMTLAHEIAVNENFQLKQNALPENSLAGQVKRVVHQAFWDVLEADLS
AEPPQYEYAIKLFEEIREILLSFLTPGGNRLHSQICEVLDIDLIRQQAEHSAVDIQGLAN
YVITTMGKICAPVRDEDIRELKATTNIVEMLRQIFRVLDLMRMDMMNFVIRNIRPHIQHH
LVEYERNKFQEVVEETPNALSQTTEWLKESIDKELLSETDVAPAAEHSSTPSLSPLLVLN
NCYLKLLQWDYQKKVLPETLMTDGPRLQELSEKLNQLKMTACVALITNNMVGAVTEGLPE
LANRLKRISAVLLEGMNKETFNLKEALHSIGVQTCAEVNKALEERGSPTLNAEVQANLVG
QLSSLEEKDNPVCTLMDKRIQLYMKGLLCLPSTQKSMPPVPGGLDVIQRELEVLGCQYAN
IVNLNKQVYGPFYANIFRKLLFRDEAVGKIDASLPTN
NT seq 1554 nt   +upstreamnt  +downstreamnt
atgcctttcaacggtgagaagcaatgtgtgagcgaggaccagcagagtgactcagagtct
tctcggttcgccgaaggcgtggcttcactcagtgactatgagtgttccaggcagagcttc
accagcgattcctccagcaaatccagctctcctgcctcaacaagccctccccggggctta
atgtttgatgatgtgatggctgcagcaaagaacttatcagacatgactctcgctcatgaa
atagctgtgaatgagaacttccagctgaagcaaaatgctctccccgagaacagccttgct
ggtcaagtgaagcgtgttgtccaccaggccttctgggatgtcttggaagcagatctcagt
gctgagcctcctcagtatgaatatgccatcaaactgtttgaagaaatcagagagattctt
ctctctttcctcacgcctggcgggaacagacttcacagccagatctgtgaggttctggac
atcgacctcattagacagcaggccgagcacagtgctgtcgacatccaaggtctggccaac
tatgtcatcaccaccatggggaagatatgtgctcctgtgagagatgaagacatccgagag
ctgaaagctaccaccaacatcgtggagatgctgagacaaatcttccgtgtcttggacctc
atgagaatggacatgatgaattttgtcattaggaatattagacctcacatccagcatcat
ttggtggaatatgagagaaacaaattccaggaagttgtagaagaaactccaaatgccctc
agtcaaaccacagagtggctgaaagagtccatagataaagaattgctttctgagactgat
gtagctcctgcagctgaacatagctccacgcctagcctgagccctctgttggtgcttaat
aactgttacttgaaactccttcagtgggattatcagaaaaaagtcttaccagagacactc
atgacagatggaccacggcttcaagaactgtcagaaaagctcaatcaattgaaaatgact
gcctgcgtggccttaatcaccaacaacatggtgggtgctgttacagaaggcctgcctgaa
cttgctaacaggttaaaaaggatttcagctgttctgcttgaaggcatgaataaagagacc
tttaacttgaaggaagccctgcattctattggtgttcagacttgtgctgaagttaacaag
gccctggaagagagaggctcgcccactttaaatgctgaggttcaagctaaccttgtcggt
cagctctccagccttgaagagaaggacaatcctgtctgcaccttgatggataaacggatc
cagttgtacatgaaaggcctgctctgtcttccaagcactcagaagagcatgcctcctgtg
ccaggtggccttgatgtcatccagcgggagctggaagtgcttggctgccagtatgcaaac
attgtgaatctcaacaaacaggtgtatggaccattttatgcaaatatattccgaaagctg
ctcttccgggatgaagccgtggggaagatagatgcttcacttcccactaactaa

DBGET integrated database retrieval system