KEGG   Mus musculus (mouse): 216227
Entry
216227            CDS       T01002                                 

Symbol
Slc17a8, BC042593, Vglu, Vglut3
Name
(RefSeq) solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 8
  KO
K12302  MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6/7/8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04721  Synaptic vesicle cycle
mmu04723  Retrograde endocannabinoid signaling
mmu04724  Glutamatergic synapse
mmu05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    216227 (Slc17a8)
   04723 Retrograde endocannabinoid signaling
    216227 (Slc17a8)
   04721 Synaptic vesicle cycle
    216227 (Slc17a8)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    216227 (Slc17a8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    216227 (Slc17a8)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC17: Vesicular glutamate transporter
   216227 (Slc17a8)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    216227 (Slc17a8)
SSDB
Motif
Pfam: MFS_1 BT1
Other DBs
NCBI-GeneID: 216227
NCBI-ProteinID: NP_892004
MGI: 3039629
Ensembl: ENSMUSG00000019935
Vega: OTTMUSG00000024564
UniProt: Q8BFU8
Position
10; 10 C2
AA seq 601 aa
MPFKAFDTFKEKILKPGKEGVKNAVGDSLGILQRKIDGTNEEEDAIELNEEGRPVQTSRA
HRPVCDCSCCGIPKRYICDCSCCGIPKRYIIAVMSGLGFCISFGIRCNLGVAIVEMVNNS
TVYVDGKPEIQTAQFNWDPETVGLIHGSFFWGYIVTQIPGGFISNKFAASRVFGAAIFLT
STLNMFIPSAARVHYGCVMGVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGS
YAGAVVAMPLAGVLVQYIGWASVFYIYGMFGIIWYMFWLLQAYECPAAHPTISNAERTYI
ETSIGEGANLASLSKFNTPWRRFFTSLPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGF
AISKVGLLSAVPHMVMTIVVPIGGQLADYLRSRKILTTTAVRKIMNCGGFGMEATLLLVV
GFSHTKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLI
VGAMTKHKTREEWQNVFLIAALVHYSGVIFYGVFASGEKQDWADPENLSEDKCGIIDQDE
LAEETELNHETFVSPRKKMSYGATTQNCEVQKTEWRQQRESAFDGEEPLSYQAEGDFSET
S
NT seq 1806 nt   +upstreamnt  +downstreamnt
atgccatttaaagcatttgataccttcaaagaaaagattttgaaacctgggaaggaagga
gtgaagaatgccgtgggagactcgctgggcatcttacaaagaaaaatcgatgggaccaat
gaagaggaagatgccattgagctgaatgaagaaggaaggcccgtgcagacgtccagagca
catcgccctgtctgtgactgcagctgctgcggcatccccaagcggtacatctgtgactgc
agctgctgcggcatccccaaacggtacatcattgctgtcatgagcggcctcggcttctgc
atttcctttgggattcggtgcaaccttggagtggccattgtggaaatggtcaacaatagc
actgtgtatgtggatgggaaaccagaaattcagacagcgcagtttaactgggacccagag
acggtgggcctgatccatggatcttttttctggggttatattgtgacacaaattcccggt
ggcttcatttcaaacaagtttgctgctagcagggtctttggagccgccatcttcttgaca
tcaactctgaacatgtttatcccttctgcggcgagggtgcattacggctgtgtcatgggt
gtgaggattttgcagggtctggtggagggtgtgacctaccctgcctgccatgggatgtgg
agtaagtgggcgcctcccctggagagaagccgtctagccacgacttccttctgtggttcc
tatgctggggcagttgttgctatgcctcttgcaggggtattggtgcagtacattggctgg
gcctctgtcttttacatctacggtatgtttgggattatttggtatatgttttggctgctg
caggcttatgagtgcccggcagctcacccaacaatatccaatgcagaaaggacctacata
gagacaagcataggagaaggggccaacttggccagtctgagcaaattcaacacaccatgg
agaaggtttttcacatccttgcctgtctatgccatcattgtggcaaacttctgtagaagc
tggaccttctatttgctcctgataagtcagccagcttactttgaggaggtctttggattt
gcaataagtaaggtgggtctcttgtcagctgtcccacacatggtgatgacaatcgtggtg
cccatcggaggacaactggctgattatttaagaagccgaaagattttgaccacaaccgct
gtcagaaagatcatgaattgtggaggctttggcatggaggcaaccttgctcctggtggtt
ggattttcccataccaaaggagtggctatctccttcctggtgcttgctgtaggatttagt
ggctttgctatttcaggcttcaatgtcaaccacctggacattgctccacgctatgccagc
atcctcatggggatctcaaatggtgtggggaccctctctggaatggtttgtcccctcatt
gttggtgcaatgactaagcacaagacccgggaggagtggcagaatgtgttcctcatagca
gcgctggtacactacagcggagtcatcttctacggggtcttcgcttctggggaaaaacag
gactgggctgacccagagaatctctctgaggacaaatgtggaatcattgaccaagatgag
ttagctgaggagacagaactcaaccacgagactttcgtaagtcccagaaagaagatgtct
tatggagccaccacccagaattgtgaggtccagaagacggagtggagacaacagagagaa
tctgccttcgacggggaggagccattatcctaccaggccgaaggagacttctcagaaaca
tcctaa

DBGET integrated database retrieval system