KEGG   Mus musculus (mouse): 216238
Entry
216238            CDS       T01002                                 

Gene name
Eea1, A430109M19Rik, B230358H09Rik, ZFYVE, ZFYVE2
Definition
(RefSeq) early endosome antigen 1
  KO
K12478  early endosome antigen 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    216238 (Eea1)
   04145 Phagosome
    216238 (Eea1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    216238 (Eea1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    216238 (Eea1)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    216238 (Eea1)
 Protein recycling
   Other Rab GTPase associated proteins
    216238 (Eea1)
SSDB
Motif
Pfam: FYVE Crescentin ATG14 ADIP zf-C2H2_4
Other DBs
NCBI-GeneID: 216238
NCBI-ProteinID: NP_001001932
MGI: 2442192
Ensembl: ENSMUSG00000036499
UniProt: Q8BL66
Position
10; 10 C2
AA seq 1411 aa
MFRRILQRTPGRVGSQGSDLDSSATPINTVDVNNESSSEGFICPQCMKSLGSADELFKHY
QAVHDAGNDSGHGGEAGLALTRDDITLLRQEVQDLQASLKEEKWYSEELKKELEKYQGLQ
QQEAKSDGLVTDSSAELQALEQQLEEAQTENFNIKQMKDLFEQKAAQLATEIADIKSKYD
EEKSLRAAAEQKVTHLTEDLNKQTTVIQDLKTELLQRPGIEDVAVLKKELVQVQTLMDNM
TLERERESEKLKDECKKLQSEHAHLEATINQLRSELAKGPQEVAVYVQEIQKLKGSINEL
TQKNQNLTEKLQKKDLDYTHLEEKHNEESASRKTLQASLHQRDLDCQQLQARLTASESSL
QRAQGELSEKAEAAQKLREELREVESTRQHLKVEVKQLQQQREEKEQHGLQLQGEVSQLH
CKLLETERQLGEAHGRLKEQRQLSSEKLMEKEQQVADLQLKLSRLEEQLKEKVTNSTELQ
HQLEKSKQQHQEQQALQQSATAKLREAQNDLEQVLRQIGDKDQKIQNLEALLQKGKESVS
LLEKEREDLYAKIQAGEGETAVLNQLQEKNHALQQQLTQLTEKLKNQSESHKQAEENLHD
QVQEQKAHLRAAQDRVLSLETSVSELSSQLNESKEKVSQLDIQIKAKTELLLSAEAAKAA
QRADLQNHLDTAQHALQDKQQELNKVSVQLDQLTAKFQEKQEHCIQLESHLKDHKEKHLS
LEQKVEDLEGHIKKLEADALEVKASKEQALQSLQQQRQLSTDLELRNAELSRELQEQEEV
VSCTKLDLQNKSEILENIKQTLTKKEEENVVLKQEFEKLSQDSKTQHKELGDRMQAAVTE
LTAVKAQKDALLAELSTTKEKLSKVSDSLKNSKSEFEKENQKGKAAVLDLEKACKELKHQ
LQVQAESALKEQEDLKKSLEKEKETSQQLKIELNSVKGEVSQAQNTLKQKEKDEQQLQGT
INQLKQSAEQKKKQIEALQGEVKNAVSQKTVLENKLQQQSSQAAQELAAEKGKLSALQSN
YEKCQADLKQLQSDLYGKESELLATRQDLKSVEEKLTLAQEDLISNRNQIGNQNKSIQEL
QAAKASLEQDSAKKEALLKEQSKALEDAQREKSVKEKELVAEKSKLAEMEEIKCRQEKEI
TKLNEELKSHKQESIKEITNLKDAKQLLIQQKLELQGRVDSLKAALEQEKESQQLMREQV
KKEEEKRKEEFSEKEAKLHSEIKEKEAGMKKHEENEAKLTMQVTTLNENLGTVKKEWQSS
QRRVSELEKQTDDLRGEIAVLEATVQNNQDERRALLERCLKGEGEIEKLQTKALELQRKL
DNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMSCGKCFSVTVRRHHCRQCGNI
FCAECSTKNALTPSSKKPVRVCDACFNDLQG
NT seq 4236 nt   +upstreamnt  +downstreamnt
atgtttcgaaggatcttgcagaggactcctgggcgagttggctctcaaggttctgattta
gattcatcagcaactcctataaatacggtggatgtcaataatgaaagttcttcagagggt
ttcatatgtccccagtgtatgaaatcccttggctctgctgatgagcttttcaagcactat
caggccgttcatgatgctggtaatgactcgggtcatggtggagaggccggtcttgctttg
acacgagatgacataacactactcagacaagaggtccaagacctacaggcctcacttaag
gaagaaaaatggtactcagaagaattaaagaaagaattagaaaaatatcaagggctacag
cagcaagaggctaaatctgatggattggtgactgattcgtcagcagagctacaggcttta
gagcaacaattagaagaagcacaaacagagaattttaatattaagcaaatgaaagatctg
tttgaacagaaagcagcccaacttgctactgaaattgcagatataaagtcaaaatatgat
gaagaaaagagtctccgagcagctgctgaacaaaaagtgacacatttgacagaagactta
aacaaacagacaactgtaattcaagatctgaaaactgaactgcttcagagacctggtata
gaagatgttgctgtactaaagaaagaactggtccaagttcaaacactaatggataacatg
actttggaacgtgagagagaatctgaaaaacttaaagatgaatgcaaaaagttacaatca
gagcatgctcatttggaggctacaataaaccagctaaggagtgaacttgccaaaggcccc
caagaagttgcagtatatgtgcaggaaatacaaaaacttaaaggttcaattaatgaatta
acacaaaaaaaccagaacttgactgaaaaattgcagaagaaagacctagactacacccac
ttagaggagaagcacaatgaagagtcagcaagtcggaagactctccaggcatccctccac
cagcgggacctggattgccagcagcttcaggcaaggctaactgcatctgaaagctcactc
cagagggcccagggagaactcagtgaaaaggcagaggctgctcagaagctcagagaagaa
ctgcgggaagtagagagcacgcgccagcatctcaaggtggaggtgaagcagctgcagcag
cagcgggaagagaaggaacagcacgggctgcagctgcagggggaagtcagccagttacac
tgcaaacttctggagaccgagcgccaactgggggaagctcacggcaggctgaaggaacag
cggcagctttccagcgagaagctgatggaaaaggagcagcaggtggctgacctacagctc
aagctctctcgtctggaggagcagttgaaggaaaaggtaacaaattccactgaattacaa
catcagttagaaaaatcaaagcaacagcatcaagaacagcaagctctacagcaaagtgct
acagccaaactccgagaagctcagaatgatttggagcaagtgttacgtcagattggagat
aaggaccaaaagatccagaaccttgaagccttgctgcagaagggtaaagaaagcgtttcc
ttactagaaaaggaaagagaagatctttatgcaaaaatccaggccggtgaaggagagact
gctgttcttaaccagttacaagagaaaaatcatgcactgcagcagcagctaactcaactg
acggagaagctgaagaatcagtcggaaagccataaacaagccgaggagaacttgcatgac
caggtacaggaacagaaggcacatcttcgagctgcacaagaccgtgttctttctctggaa
accagtgtcagtgaactaagcagtcagttaaatgaaagcaaggagaaggtctcgcagctt
gacatacagattaaagccaaaactgaattattactatcagcagaagcagcaaaagctgct
cagagagctgatcttcagaatcacttggacacagctcaacatgcgttacaggataaacaa
caggagttaaataaggtcagtgtgcagttggatcagctcactgcaaagtttcaggagaag
caggagcattgcattcagctggaaagccaccttaaggatcacaaggagaagcacctctct
ttagaacaaaaagttgaagacttagaaggccacattaagaaactagaagctgatgctctt
gaagttaaagccagcaaggaacaggctttgcagagtctacagcagcagaggcagctgagc
acagacctggagttgagaaatgcagagctgagtagagagctccaggagcaggaggaagta
gtatcttgtacaaaactggatctacagaataaatctgaaatccttgaaaatatcaaacaa
accctcaccaagaaagaagaagaaaatgtcgtcttgaaacaagaatttgaaaagttaagt
caagattcaaagacacagcacaaggagctgggggacaggatgcaagctgcggtcacagag
ctgacagcagtgaaggcacagaaggacgcactcctggccgagctttctacaacaaaagaa
aaactgtcaaaagtttcggattctttaaaaaactccaaaagtgaatttgagaaagaaaat
cagaaaggaaaagctgctgtattagatttggaaaaagcttgtaaagaattaaagcatcag
cttcaagtacaggcagagagtgccctgaaggagcaggaggacctgaaaaagtcactcgag
aaagagaaagagacttctcagcagttgaagatagaactcaattcagtcaagggagaagtc
tcacaggctcaaaatacattaaagcaaaaggagaaagacgaacaacagcttcaggggacc
ataaatcagctaaagcaatcagctgaacaaaagaaaaaacaaattgaagcgcttcaagga
gaggttaaaaatgctgtttcacaaaagacagtgctggagaataagctgcagcagcagtca
tcacaggcagcccaggagcttgcagcagagaaaggaaaactgtcagcgctgcagagcaac
tacgagaagtgccaggcggacctgaaacagctgcagtccgacctctatggcaaagagtct
gaacttctagccacgaggcaagaccttaagtctgtagaagagaagctcactctggcacaa
gaagacttgatttcaaacagaaatcaaattggaaaccaaaataaatcaattcaagaattg
caagccgccaaagctagtttggagcaggactcagcaaagaaagaggcgctgctaaaggag
cagagtaaggcacttgaggatgctcagagagaaaagtcagtgaaggaaaaagaactagta
gctgaaaagtctaaattggcagagatggaggaaattaaatgtagacaagaaaaagaaatc
acaaaactcaatgaggagctcaagtcgcacaaacaagaaagcataaaggaaataacaaat
ctcaaggatgccaagcaacttttgattcaacagaaattagaacttcaaggcagagtggac
tcactgaaggcagctcttgagcaggagaaggagagtcagcagctgatgcgagagcaggtg
aagaaggaggaagagaagcggaaggaagagttttctgagaaggaagcgaagctgcattct
gaaataaaagaaaaggaagcgggaatgaagaaacacgaagaaaacgaggctaagcttact
atgcaggtcacaacattaaatgaaaacttgggtactgtgaagaaggagtggcagtctagt
caacggagagtcagtgagcttgagaagcaaacggatgacttacggggagaaattgctgtc
ttagaagcaactgttcagaataatcaagacgaaagaagagcactcctagagaggtgtctt
aaaggcgaaggtgaaatagaaaagcttcagaccaaagccctagagctgcagagaaagctg
gataacacaactgcggccgtgcaggagctgggcagggagaaccagtctctccagatcaaa
cacacacaagcattgaacagaaagtgggcggaagacaacgaagtgcagaactgcatgtcc
tgtgggaagtgcttctccgtcaccgtgcggcggcatcactgccgacagtgtgggaatatc
ttctgtgccgagtgctcaaccaaaaatgccttaactccttcttcgaagaagcctgttcgt
gtctgtgatgcatgcttcaatgatttgcaaggataa

DBGET integrated database retrieval system