KEGG   Mus musculus (mouse): 216274
Entry
216274            CDS       T01002                                 

Symbol
Cep290, BC004690, Nphp6, b2b1454Clo, b2b1752Clo
Name
(RefSeq) centrosomal protein 290
  KO
K16533  centrosomal protein CEP290
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    216274 (Cep290)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Centriolar satellite
     216274 (Cep290)
   TCTN-B9D complex
    216274 (Cep290)
SSDB
Motif
Pfam: CEP209_CC5
Other DBs
NCBI-GeneID: 216274
NCBI-ProteinID: NP_666121
MGI: 2384917
Ensembl: ENSMUSG00000019971
UniProt: Q6A078 E9Q9M0
Position
10 D1; 10 51.48 cM
AA seq 2479 aa
MPPNIKWKELIKVDPDDLPRQEELADKLLISLSKVEVNELKNEDQENMIHLFRITQSLMK
MKAQEVELALEEVEKAGEEQAKFENQLKTKVMKLENELEMAQQSAGGRDTRFLRDEIRQL
EKQLEQKDRELEDMEKELDKEKKVNEQLALRNEEAENENSKLRRENKRLKKKNEQLRQDI
IDYQKQIDSQKESLLSRRGEDSDYRSQLSKKNYELVQYLDEIQTLTEANEKIEVQNQEMR
KNLEESVQEMEKMTDEYNRMKALVHQSDAVMDQIKKENEHYRLQVRELTDLLKAKDEEDD
PVMMAVNAKVEEWKLILSSKDDEIIEYQQMLQSLRGKLKNAQLDADKSNIMALKQGIQER
DSQIKMLTEQVEQYTKEMEKNTFIIEDLKNELQKDKGTSNFYQQTHYMKIHSKVQILEEK
TKEAERIAELAEADAREKDKELVEALKRLKDYESGVYGLEDAVIEIKNCKAQIKIRDGEM
EVLTKEINKLEMKINDILDENEALRERAGLEPKTMIDLTEFRNSKRLKQQQYRAENQVLL
KEIESLEEERLDLKRKIRQMAQERGKRNAASGLTIDDLNLSETFSHENKIEGRKLNFMSL
NNMNETQSKNEFLSRELAEKEKDLERSRTVIAKFQSKLKELVEENKQLEEGMKEILQAIK
DMPKDSDVKGGETSLIIPSLERLVNAMESKNAEGIFDASLHLKAQVDQLTGRNEELRQEL
RQSRKEAVNYSQQLVKANLKIDHLEKETDLLRQSAGSNVVYKGIDLPDGIAPSSAYIINS
QNEYLIHLLQELDNKEKKLKHLEDSLEDYNRKFAVIRHQQSLLYKEYLSEKDIWKTDSEM
IREEKRKLEDQAEQDAVKVKEYNNLLSALQMDSNEMKKMLSENSRKITVLQVNEKSLIRQ
YTTLVEMERHLRKENGKHRNDVIAMEAEVTEKLGSLQRFKEMAIFKIAALQKVIDNSVSL
SELELANKQYNELTTKYRDILQKDNMLVQRTSNLEHLECENASLKEQMEAISKELEITKE
KLHTIEQAWEQETKLGNDSNMDKAKKSMTNSDIVSISKKITVLEMKELNERQRAEHCQKM
YEHLRTSLKQMEERNFELETKFTELTKINLDAQKVEQMLRDELADSVTKAVSDADRQRIL
ELEKSEVELKVEVSKLREISDIAKRQVDFLNSQQQSREKEVESLRTQLLDFQAQSDEKAL
IAKLHQHVVSLQISEATALGKLESVTSKLQKMEAYNLRLEQKLDEKEQALYYARLEGRNR
AKHLRQTIQSLRRQFSGALPLAQQEKFSKTMIQLQNDKLKIMQEMKNSQQEHRNMENKTL
ELELKLKGLEELISTLKDARGAQKVINWHVKIEELRLQELKLNRELVKGKEEIKYLNNII
SEYEHTINSLEEEIVQQSKFHEERQMAWDQREVELERQLDIFDHQQNEILSAAQKFEDST
GSMPDPSLPLPNQLEIALRKIKENIQVILKTQATCKSLEEKLKEKESALRLAEQNILSRD
KVINELRLRLPATADREKLIAELERKELEPKSHHTMKIAHQTIANMQARLNHKEEVLKKY
QHLLEKAREEQREIVKKHEEDLHVLHHKLEQQADNSLNKFRQTAQDLLKQSPAPVPTNKH
FIRLAEMEQTVAEQDDSLSSLLTKLKKVSKDLEKQKEITELKVREFENTKLRLQETHASE
VKKVKAEVEDLRHALAQAHKDSQSLKSELQAQKEANSRAPTTTMRNLVDRLKSQLALKEK
QQKALSRALLELRSEMTAAAEERIIAVTSQKEANLNVQQVVERHTRELKSQIEDLNENLL
KLKEALKTSKNKENSLADDLNELNNELQKKQKAYNKILREKDGIDQENDELRRQIKRLSS
GLQSKTLIDNKQSLIDELQKKVKKLESQLERKVDDVDIKPVKEKSSKEELIRWEEGKKWQ
TKVEGLRNRLKEKEGEAHGLAKQLNTLKELFAKADKEKLTLQKKLKTTGMTVDQVLGVRA
LESEKELEELKKKNLDLENDILYMRTQQALPRDSVVEDLHLQNKYLQEKLHTLEKKLSKE
KYSQSLTSEIESDDHCQKEQELQKENLKLSSENIELKFQLEQANKDLPRLKNQVKDLKEM
CEFLKKGKLELERKLGQVRGAGRSGKTIPELEKTIGLMKKVVEKVQRENEQLKKASGILT
SEKMATIEEENRNLKAELEKLKAHFGRQLSMQFESKNKGTEKIVAENERLRKELKKEIEA
SEKLRIAKNNLELVNDKMAAQLEETGKRLQFAESRAPQLEGADSKSWKSIVVSRVYETKM
KELESDIAKKNQSITDLKQLVREATEREQKAKKYTEDLEQQIEILKNVPEGAETEQELIR
ELQLLRLANNQMDKERAELIHQIEINKDQTRADSSIPDSDQLKEKINDLETQLRKLELEK
QHSKEEVKKLKKELENFDPSFFEEIEDLKYNYKEEVKKNILLEEKLKKLSEQFGFELPSP
LAASEHSEDGESPHSFPIY
NT seq 7440 nt   +upstreamnt  +downstreamnt
atgccacctaatataaagtggaaagaattaatcaaagttgatccagatgacctgccacgg
caagaagagttagcagataaattattgatatctttatccaaggtggaagtaaatgaacta
aaaaatgaagaccaagaaaacatgatacatctattcagaattacccagtctctaatgaag
atgaaagcccaggaagtagagctcgctttggaagaagttgaaaaggctggagaagaacaa
gcaaaatttgaaaatcaattaaagacaaaagtaatgaaactggaaaatgaactggagatg
gctcagcagtctgcagggggacgtgacactcggtttttacgtgacgaaattcgccaactt
gagaagcagctggaacaaaaagatagagaattagaggatatggaaaaagaattggataaa
gaaaagaaggttaatgaacaattggctcttcgaaatgaggaggcagaaaatgaaaacagc
aaattaagaagagagaacaaacgtctaaagaaaaagaatgagcagcttcggcaggacatt
attgactaccagaaacaaatagattcacagaaagaatcacttctgtcaaggagaggagaa
gacagtgactaccgatcacagttgtctaaaaagaactatgaacttgttcaatatctggac
gaaatacagaccttaacagaagctaatgagaagattgaagttcagaaccaagaaatgagg
aaaaacctggaagagtctgtgcaggagatggagaagatgactgatgagtacaacaggatg
aaagcgcttgtgcatcagtcggatgctgtcatggaccagatcaagaaggagaatgagcac
tatcgcctgcaagttcgagagctcacggatcttctgaaggcgaaggatgaagaggacgat
ccagtcatgatggctgttaacgcaaaagtggaagagtggaagttaattttgtcttctaaa
gatgatgaaatcattgaatatcagcaaatgctacagagtctgagagggaaacttaaaaat
gcccaacttgatgcagacaaaagtaacatcatggctctgaaacagggtatccaggagcga
gacagtcaaattaagatgcttactgagcaagtagaacagtatacgaaagaaatggaaaaa
aatacgtttattattgaagatttgaaaaatgaactccaaaaagacaaaggtacttcaaac
ttttatcagcagactcattatatgaaaattcactcaaaagtacaaattttagaagagaaa
acaaaagaggccgagagaatagctgagctggctgaggctgatgccagggagaaggacaaa
gaattggttgaggctctgaagagattaaaagattatgaatctggagtatatggcttagaa
gatgctgttatcgaaataaagaattgtaaagcccaaattaaaataagagatggagagatg
gaagtgttgaccaaggagatcaataagcttgagatgaagatcaatgacatccttgatgaa
aacgaagcccttagagagcgggctggccttgaacccaagacaatgattgatttgactgaa
tttagaaacagcaaacggttaaagcagcaacagtacagagctgagaaccaggttcttttg
aaagagatcgaaagtctagaggaggagcgtcttgacttgaaaagaaagattcgtcaaatg
gctcaagaaagaggcaaaaggaacgcagcctcaggattaaccattgacgacttgaactta
tctgaaaccttttctcatgaaaataaaatagaaggaagaaaactaaattttatgagcctc
aataatatgaatgaaacacaatcaaagaatgagtttctttcaagagaattggctgaaaag
gaaaaagatttagaaagaagtaggacagtaattgctaaattccagagtaaactaaaagaa
ttagtcgaagaaaataagcaacttgaagaaggtatgaaagaaattttgcaagctattaag
gacatgccgaaggattctgatgtgaaaggaggtgaaacatctttaatcatcccgagtctt
gaaagactggttaacgctatggaatcaaagaatgcagaaggaatcttcgatgccagcttg
catctaaaagcccaagttgaccaacttacaggaaggaatgaagaattaaggcaagaactc
aggcaatctcggaaagaggctgtaaattattcacagcagttggtaaaagcaaacttaaag
attgaccaccttgagaaggaaactgaccttctacgtcagtctgcaggctccaatgtagta
tacaaaggcatagacttacccgatgggatagcaccatccagtgcctatatcatcaattct
cagaatgaatacttaatacatcttttgcaggaactagacaataaagaaaagaaattaaaa
catttagaagattcccttgaagattataacagaaagtttgcagtgattcgtcatcaacaa
agtttattatataaagaatacctaagtgaaaaggatatttggaaaacagactctgagatg
ataagagaggagaagagaaaactggaagatcaagctgagcaggatgctgtgaaagtaaaa
gagtacaacaatttgctcagtgctcttcagatggattcgaacgagatgaagaaaatgctc
tcagaaaacagtaggaaaatcaccgttctgcaagtgaacgagaagtccctcatccggcag
tacaccaccttagtggagatggagcggcacctgagaaaggaaaacgggaaacacaggaat
gacgtcatagccatggaagccgaagtcactgaaaaacttggaagtttgcaaagattcaag
gaaatggccatcttcaagattgcagctcttcagaaggttatagataatagtgtttctttg
tctgaattagaactagccaataaacagtacaatgagctgactactaagtacagggacatc
ttgcagaaagataatatgcttgttcaaagaacaagtaacttagaacacctggagtgtgag
aatgcatcgctaaaagaacagatggaggctatcagtaaagagctggagattacaaaggaa
aaactccataccattgaacaggcctgggaacaagaaacgaagttaggaaatgactcaaac
atggataaggctaagaaatcaatgacaaacagtgacattgtttctatttcaaagaaaatc
actgtgttggagatgaaggaattaaatgaaaggcagagggctgaacactgtcagaaaatg
tatgagcacttaaggacttcattaaagcaaatggaagaacgtaattttgaattggaaacc
aagttcactgagcttactaaaatcaacctggatgcacaaaaggtggagcagatgttgaga
gacgaattagctgatagtgtgaccaaggcagtaagtgatgctgaccgacagcggattcta
gaactagagaagagtgaagtggagctcaaagttgaagtgtccaagctgagagagatttca
gatattgccaaaagacaagttgattttttgaattcgcaacaacagtccagggaaaaggaa
gtggaatccctcagaacgcagctgctggacttccaggcacaatctgacgaaaaggctcta
attgccaaattgcaccaacatgttgtctctcttcaaattagtgaggccactgccctcggt
aagttagagtcagttacgtccaaactccagaagatggaagcctacaatttgcgcttagaa
cagaaactggatgaaaaagagcaggcgctctactatgctcgtttggaaggtagaaacaga
gcaaaacacctgcgccaaaccattcagtcgcttcgaagacagttcagtggagctctaccc
ttagcacagcaggaaaagttctccaaaacgatgattcagttgcaaaatgacaaacttaag
ataatgcaagaaatgaagaattcgcaacaggaacacagaaatatggaaaacaaaacactg
gagttggaattaaaattaaaaggcttagaagaattgatcagtactttaaaggatgccagg
ggagcccagaaggtaatcaattggcatgtgaaaatagaagaacttcgcctccaagaactt
aagctaaatagagaactagtcaagggtaaagaagaaatcaaatatttgaataatatcatc
tctgaatatgagcatacaatcaacagtctagaggaagaaattgttcagcaaagcaagttc
catgaagaaagacagatggcttgggatcaaagagaagttgagctggaacgccagttagac
atttttgatcatcagcaaaatgaaatactcagtgcagcacaaaagtttgaagactctaca
ggatcaatgccagaccccagcttgcctcttccaaaccaacttgaaattgctctaagaaaa
attaaggagaatattcaagtaattcttaaaacacaagcaacttgcaagtcactagaagag
aaactaaaagaaaaagaatctgctttacggttggcagagcaaaatattctgtcaagagac
aaagtaatcaatgaactgaggcttcgattgcctgccacggctgatcgagaaaaacttata
gctgagctagaaagaaaagagctggagccgaaatctcatcacacaatgaaaattgcccac
caaactattgccaacatgcaggcaaggttaaatcacaaggaagaagtattgaagaaatac
cagcaccttctggagaaggccagagaggagcaaagagaaattgttaagaagcatgaggaa
gaccttcatgttcttcatcacaaattagaacaacaggccgataattcactcaataaattc
agacagacagctcaggatttacttaagcagtctcctgctccagttcccaccaacaaacat
ttcattcgtctggccgagatggagcagacagtagcagaacaagatgactctctgtcctca
cttttgaccaaactaaagaaagtatcaaaagatttggaaaaacaaaaagaaatcactgag
ttaaaagtcagagagtttgaaaataccaaactacggctccaagaaactcatgccagtgag
gtaaagaaagtgaaagcagaggtagaggacttaaggcatgctctagcccaagcacacaag
gactcccagagtttaaagtctgaactccaggctcagaaagaagcaaactccagagctcca
acaaccacaatgaggaatcttgtagacaggctaaagagccaactagccttgaaagagaag
caacaaaaggcacttagtcgagccctgttggaacttcggtcggaaatgacagcagcagct
gaggaacgtataatcgctgtaacttctcaaaaagaggcaaatctcaatgttcaacaagtt
gttgagcgccatactagagagctaaagtcacaaattgaagatttaaatgaaaatctttta
aaattgaaagaagctcttaaaacaagtaagaacaaagaaaattcactagctgatgattta
aatgaattaaataatgaactgcaaaaaaagcaaaaagcttataataaaatccttagagag
aaagatggaattgatcaagaaaatgatgaactgagaagacagattaaaagactgtccagt
ggactgcagagcaaaactttgatagataacaagcaaagtttaatcgatgaacttcaaaag
aaagttaaaaaacttgaaagccaactggaaagaaaggtggatgacgtagacataaagccg
gtgaaggaaaagagtagtaaagaagaattaattaggtgggaagaaggtaagaaatggcaa
accaaagtagagggactacgaaacagactaaaggagaaggaaggagaagcccacggcctg
gcaaagcagctgaataccttaaaggaactttttgccaaagctgataaagagaaacttact
ttgcagaagaaactgaaaacaacaggaatgactgttgaccaggttttaggagtgcgagct
ttggaatctgaaaaagagttggaagagctaaaaaagaaaaatctggacctagaaaatgac
atattatacatgaggacccagcaggctcttccacgagattctgttgtggaagacttacat
ttacaaaataaataccttcaagaaaaacttcatactttagaaaaaaaactttcaaaggag
aaatattctcagtctttgacttcagaaatagagtcagatgatcactgtcaaaaagaacaa
gaacttcagaaggaaaatttgaagttgtcatctgaaaacatcgagctgaaatttcaactt
gaacaagcaaataaagatttgccaagactaaagaatcaagtgaaagatttgaaggaaatg
tgtgaatttcttaagaaaggaaaactggaacttgagcggaagcttggtcaggtcagaggg
gctggtagaagtgggaagacaatcccagaactagaaaaaaccattgggttaatgaagaaa
gtagttgaaaaagtccaaagagaaaatgaacaattgaaaaaggcatcaggaatactgact
agtgaaaaaatggctactattgaggaagaaaatagaaacttaaaggctgaactagaaaag
cttaaagctcactttggacgtcagttgagtatgcagtttgaatctaagaacaaaggtact
gagaaaattgttgccgaaaatgaacggcttcggaaagaacttaagaaagaaatagaagcc
tctgagaaactgcggatagctaagaacaacttagagctggtgaacgacaagatggcagct
caactcgaagaaactgggaagagactacagtttgcagaaagtagagccccacagctggaa
ggtgctgacagcaagagctggaagtcaattgtggtctcaagagtgtatgagaccaagatg
aaagagcttgaaagtgacattgccaaaaagaatcaaagtatcactgaccttaaacagctt
gtaagagaagcaacagagagagaacagaaagctaagaaatacactgaagaccttgaacaa
cagattgagatcctcaaaaatgttcctgaaggtgccgagacagagcaagagcttatacgg
gaactccagcttcttagattagccaataatcagatggataaagaaagggcagaattaatc
catcagatagaaattaacaaggaccaaaccagagctgacagtagcatacctgattctgat
caactaaaggaaaagataaatgacctggagacacaactcagaaagttggagctagaaaag
caacattcgaaggaggaagttaaaaagctgaaaaaagaactggaaaattttgatccttca
ttttttgaagaaattgaagacctgaagtataattataaggaagaagtgaaaaagaatatc
ctattagaagagaagctaaaaaaactgtcggaacagtttggatttgaactgcctagtcct
cttgctgcttctgaacactcggaagatggagaaagtcctcatagtttccctatttattag

DBGET integrated database retrieval system