KEGG   Mus musculus (house mouse): 216285
Entry
216285            CDS       T01002                                 
Symbol
Alx1, AI314867, C130005I02, Cart1
Name
(RefSeq) ALX homeobox 1
  KO
K09334  ALX homeobox protein 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    216285 (Alx1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain Paired-related
    216285 (Alx1)
SSDB
Motif
Pfam: Homeodomain OAR Homeobox_KN
Other DBs
NCBI-GeneID: 216285
NCBI-ProteinID: NP_766141
MGI: 104621
Ensembl: ENSMUSG00000036602
UniProt: Q8C8B0
Position
10:complement(102843708..102865501)
AA seq 326 aa
MEFLSEKFALKSPPSKNSDFYMGTGGALEHVMETLDNESFYGKATAGKCVQAFGPLPRAE
HHVRLDRTSPCQDSSVNYGITKVEGQPLHTELNRAMDNCNNLRMSPVKGMPEKSELDELG
DKCDSNVSSSKKRRHRTTFTSLQLEELEKVFQKTHYPDVYVREQLALRTELTEARVQVWF
QNRRAKWRKRERYGQIQQAKSHFAATYDISVLPRTDSYPQIQNNLWAGNASGGSVVTSCM
LPRDASSCMTPYSHSPRTDSSYTGFSNHQNQFSHVPLNNFFTDSLLTGATNGHAFETKPE
FERRSSSIAVLRMKAKEHTANISWAM
NT seq 981 nt   +upstreamnt  +downstreamnt
atggagtttctgagcgagaagtttgccctgaagagcccgccaagtaaaaacagtgacttt
tacatgggcacaggaggcgcgttggagcacgttatggagacgctggacaatgagtccttt
tacggcaaagcgacggctggcaaatgcgtgcaggccttcgggccgctgccgcgagcggag
catcacgtgcgcctggacaggacttcgccctgtcaggacagcagcgtgaactatggaatc
accaaagtggaaggacagccccttcacaccgagctgaatagagcaatggataactgcaac
aatctcaggatgtctcccgtgaaagggatgccagagaagagcgaactggatgaacttggg
gacaaatgtgacagcaatgtatccagcagcaaaaagaggagacaccgaactacctttacc
agtttgcagctggaggaactggagaaagttttccagaaaacccattacccagatgtatat
gtcagagaacaacttgccctgagaacggagctcactgaggccagggtccaggtttggttt
caaaatcgaagggccaagtggagaaaaagagaacgatacggccaaatacagcaagctaaa
agccatttcgctgccacgtacgacatatcagtcttaccaaggacggacagctacccacag
atccagaacaatttgtgggcaggaaatgctagcggtggttctgtggttacgtcatgcatg
ctaccacgtgacgcgtcctcctgcatgacaccttactctcactcgcctcggacagattcc
agttatacggggttttcgaaccaccagaatcagttcagccacgtgcccctcaataatttt
ttcactgactctcttctcactggagctaccaacggacacgcatttgaaacaaagccggag
tttgaaaggaggtcttccagtatcgctgttctgagaatgaaggccaaggagcacaccgcc
aatatttcatgggccatgtaa

DBGET integrated database retrieval system