KEGG   Mus musculus (mouse): 216292
Entry
216292            CDS       T01002                                 

Gene name
Mettl25
Definition
(RefSeq) methyltransferase like 25
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Methyltransf_32 Methyltransf_11 Methyltransf_25 Methyltransf_23 Methyltransf_31 Methyltransf_12
Other DBs
NCBI-GeneID: 216292
NCBI-ProteinID: NP_997405
MGI: 3041259
Ensembl: ENSMUSG00000036009
Vega: OTTMUSG00000040134
UniProt: Q6NXH8 A0A0R4J0G2
Position
10; 10 D1
AA seq 600 aa
MSVMAAACPLPRTPDLPTLHDKLQGLLSFLRGALAISSAHTVDFYTKSVWQELVDLPPES
VLAALRESAVEAEPREAETGSGFTELPKIFCETSQKLLSVEAFARTAKHYSVQNLGLCTP
SEQLLTALQGNKRQRVDENVKAIEFMNTKKSHEVQAMSELICSIADYCGLKQIIDVGSGK
GYLSSFLSLKYGLNVYGIDSSNTNTHGAKERNRKLKKHWSLYHPHSRADANGWASERPRE
LKVPKGVECKGDAESVQRSRLGNPDLSATDGLPDFSGSAISVIRKQQKNVLAQPAEEENL
YFEDAFSLIDFLPVDAIEPTSSQVQNTEKSGLRKERRNTASKARDSSIYSPLTSFITADS
QLHDIIEDLEDCLMVGLHTCGDLAPSTLRIFTSKAEVKAVCSVGCCYHLLSEEFENQHKD
RCANENWGFPMCHYLKEERWCCGRNARMSACLALQRVAVGQGLPTESLFYRAVLQNIIKD
YYGISKCEQHVGKIYSKCSSFLEYVRMSLKKLGLDESKVSEEIIMDYYENYKPRMNELEA
FNMLKVVLAPCIETLILLDRLCYLKEQDGVAWSALVKLFDPVQSPRCYAVIALKKQCDRG
NT seq 1803 nt   +upstreamnt  +downstreamnt
atgagcgtcatggcggcggcctgccctctgcccaggaccccggacctgcccacgctgcac
gacaagttacagggcttgctgagcttcctcaggggcgccctggccatttccagcgcgcac
acggtggacttctacaccaagtcggtctggcaggagctggtcgacctgccccctgagagc
gtgctggcggcgctgagggagtcggcggtggaggccgagccgcgcgaggcagagacggga
tcaggtttcactgagctccccaaaatattttgtgaaacttctcagaagctgttgagtgtg
gaagcttttgcccgaactgcaaagcactattctgtgcaaaacttgggactgtgcactcct
tctgagcagttgctcacagccctccaaggaaataaaaggcagagagttgatgaaaatgtg
aaggcaattgagtttatgaatacaaaaaaatctcatgaggttcaggcaatgtcagagcta
atctgcagtattgctgattactgtggcttaaagcagataattgacgtgggttctggtaaa
ggctatctaagctcctttttgtccttaaaatatggtttgaacgtttatggcatcgattcc
tcaaacactaacactcacggcgcgaaggagagaaacaggaagttgaagaagcattggagc
ctgtatcaccctcactcaagagcagacgccaacggctgggcatcagaaaggcccagagag
ttgaaagtgccaaagggagtggagtgtaagggggacgctgagagcgtgcagaggagcagg
cttgggaatccagacctgtctgccaccgatggtttgcctgatttctcaggctctgcaatt
tcagtcatcagaaaacagcaaaaaaacgtgcttgctcagccagctgaggaagaaaatttg
tattttgaagatgccttttctctcatagactttttacctgttgatgccatcgaacctact
tcatcacaggtgcagaacacagaaaagtctggactgagaaaagagagaagaaatacggca
tccaaggcaagggactcaagcatatattcaccactaacctctttcatcactgctgattca
caattgcatgacattattgaagatctggaggactgtttaatggtgggactgcatacctgt
ggtgaccttgcacccagtactctgcggatatttacatccaaggctgaagtcaaggcagtt
tgcagtgtgggttgttgctaccatctcctatctgaggagtttgaaaaccagcataaagat
agatgtgctaacgaaaactgggggtttccaatgtgccactatctgaaagaggagagatgg
tgctgcggccgtaatgcaagaatgtcagcatgtttggcattgcagcgggttgcagttggc
caagggctgcctactgaatcactcttctatcgtgctgttcttcagaatattattaaggat
tattatggcatcagcaaatgtgaacagcacgttggtaaaatttattccaaatgttcctct
tttctggagtatgtcagaatgtctctaaagaagcttggattagatgagtccaaggtctct
gaagaaattataatggactactatgagaattataagcctagaatgaatgagctagaggca
tttaatatgttgaaagttgttctggctccttgcatagaaacactgattcttcttgatcga
ctttgttacctgaaggaacaggacggtgtagcctggtctgccctcgtgaagttgtttgac
cctgtgcagtcgcccagatgctacgctgtcattgctctgaagaagcagtgtgatcgtggc
tga

DBGET integrated database retrieval system