KEGG   Mus musculus (mouse): 216344Help
Entry
216344            CDS       T01002                                 

Gene name
Rab21, 9630024B22
Definition
(RefSeq) RAB21, member RAS oncogene family
  KO
K07890  Ras-related protein Rab-21
Organism
mmu  Mus musculus (mouse)
Brite
Membrane trafficking [BR:mmu04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab GTPases
    216344 (Rab21)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   216344 (Rab21)
  Exosomal proteins of other body fluids (saliva and urine)
   216344 (Rab21)
GTP-binding proteins [BR:mmu04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab20/21/24 [OT]
    216344 (Rab21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf RsgA_GTPase GTP_EFTU MMR_HSR1 Gtr1_RagA PduV-EutP FeoB_N
Motif
Other DBs
NCBI-GeneID: 216344
NCBI-ProteinID: NP_077774
MGI: 894308
Ensembl: ENSMUSG00000020132
UniProt: P35282 Q0PD35
Position
10; 10 D2
AA seq 222 aa AA seqDB search
MAAAGGGAAAAAGRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLN
IGGKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDVTDEDSFQKVKNWVKELRKMLG
NEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIE
TAQVDERAKGNGSSQAGAARRGVQIIDDEPQAQSSGGCCSSG
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggctgcggccggcggcggggcggcggcggcggcgggccgagcctactccttcaaggtg
gtgctgctcggggaaggctgcgtggggaagacgtcgctggtgctgcgctactgcgagaac
aagttcaacgacaagcacatcaccaccctgcaggcatctttcttaacaaagaagttaaat
attggtggaaaaagagtaaaccttgccatatgggacacagcaggtcaggagagattccac
gcactgggcccaatttactaccgagattcgaacggagctattttagtttatgatgtaacg
gatgaagattcctttcagaaggtaaaaaactgggtcaaagaattacgaaaaatgttggga
aatgagatctgtttgtgtatagttggtaataaaatagacttggaaaaggagaggcacgtc
tctattcaagaagcagaatcgtatgcagagtctgtgggagccaagcattaccatacttcc
gctaaacagaacaaaggcattgaggagctctttctcgacctttgtaaaagaatgatagag
acagcccaggtggatgagagagcaaaaggcaatggctcgagtcaagccggggctgcaagg
cgaggtgtgcagatcatcgacgacgagcctcaagctcagagcagcggagggtgctgttcc
tccggctaa

DBGET integrated database retrieval system