KEGG   Mus musculus (mouse): 216344
Entry
216344            CDS       T01002                                 

Gene name
Rab21, 9630024B22
Definition
(RefSeq) RAB21, member RAS oncogene family
  KO
K07890  Ras-related protein Rab-21
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    216344 (Rab21)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    216344 (Rab21)
   04031 GTP-binding proteins [BR:mmu04031]
    216344 (Rab21)
Membrane trafficking [BR:mmu04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab GTPases
    216344 (Rab21)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   216344 (Rab21)
  Exosomal proteins of other body fluids (saliva and urine)
   216344 (Rab21)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab20/21/24 [OT]
    216344 (Rab21)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase GTP_EFTU MMR_HSR1 Gtr1_RagA PduV-EutP FeoB_N
Other DBs
NCBI-GeneID: 216344
NCBI-ProteinID: NP_077774
MGI: 894308
Ensembl: ENSMUSG00000020132
UniProt: P35282 Q0PD35
Position
10; 10 D2
AA seq 222 aa
MAAAGGGAAAAAGRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLN
IGGKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDVTDEDSFQKVKNWVKELRKMLG
NEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIE
TAQVDERAKGNGSSQAGAARRGVQIIDDEPQAQSSGGCCSSG
NT seq 669 nt   +upstreamnt  +downstreamnt
atggctgcggccggcggcggggcggcggcggcggcgggccgagcctactccttcaaggtg
gtgctgctcggggaaggctgcgtggggaagacgtcgctggtgctgcgctactgcgagaac
aagttcaacgacaagcacatcaccaccctgcaggcatctttcttaacaaagaagttaaat
attggtggaaaaagagtaaaccttgccatatgggacacagcaggtcaggagagattccac
gcactgggcccaatttactaccgagattcgaacggagctattttagtttatgatgtaacg
gatgaagattcctttcagaaggtaaaaaactgggtcaaagaattacgaaaaatgttggga
aatgagatctgtttgtgtatagttggtaataaaatagacttggaaaaggagaggcacgtc
tctattcaagaagcagaatcgtatgcagagtctgtgggagccaagcattaccatacttcc
gctaaacagaacaaaggcattgaggagctctttctcgacctttgtaaaagaatgatagag
acagcccaggtggatgagagagcaaaaggcaatggctcgagtcaagccggggctgcaagg
cgaggtgtgcagatcatcgacgacgagcctcaagctcagagcagcggagggtgctgttcc
tccggctaa

DBGET integrated database retrieval system