KEGG   Mus musculus (mouse): 216395Help
Entry
216395            CDS       T01002                                 

Gene name
Rxylt1, 6330415D21Rik, Tmem5
Definition
(RefSeq) ribitol xylosyltransferase 1
  KO
K21052  alpha-dystroglycan beta1,4-xylosyltransferase [EC:2.4.2.61]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00515  Mannose type O-glycan biosynthesis
mmu01100  Metabolic pathways
Module
mmu_M00872  O-glycan biosynthesis, mannose type (core M3)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosynthesis
    216395 (Rxylt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    216395 (Rxylt1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.61  alpha-dystroglycan beta1,4-xylosyltransferase
     216395 (Rxylt1)
Glycosyltransferases [BR:mmu01003]
 Glycan extension
  O-Glycan
   216395 (Rxylt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Exostosin
Motif
Other DBs
NCBI-GeneID: 216395
NCBI-ProteinID: NP_694699
MGI: 2384919
Ensembl: ENSMUSG00000034620
Vega: OTTMUSG00000027721
UniProt: Q8VDX6
Position
10; 10 D2
AA seq 444 aa AA seqDB search
MRLTRTRLCSLLVALYCLFSIYAAYHVFFGRRRRPLGTTSRNSRKAAAAQAKERRGREQS
ALESEEWNPWEGDEKNEQRHRVKTNLQILNKSTKEKIEHRVQIWGKAAIGLYLWEHIFEG
TLDPADVTAQWREGQSVVGRTHYSFITGPAVVPGYFSIDVDNVVLVLNGREKAKIFHATQ
WLIYAQNLMKTQKLQHLAVVLLGNEHCENDWIMQFLKRNGGFVDLLFITYDSPWINGADI
LQWPLGVATYRQFPVVEASWTMLHDERPYICNFLGTAYENSSRQALMNILKQDGNDKLCW
VSAREQWQPQETNESLKNYQDALLHSDLTLCPVGVNTECYRIYEACSFGSIPVVEDVMTA
GHCGNTTSQHSAPLQLLKAMGAPFIFIKNWKELPAILEKEKTISLQEKIQRRKVLLHWYQ
HFKTELKWKFTKILESSFFINNKV
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgacgcggacacggctgtgctccctcctcgtcgccctgtactgcctcttctcc
atctacgccgcctaccacgtcttcttcgggcgccgccgccggccgctgggcacgacctct
cggaactccaggaaggcggcggcggcgcaggcgaaggagaggcgcggccgagagcagtcc
gctttggagagtgaagaatggaatccttgggaaggagatgaaaaaaacgagcagcgacac
agagttaagaccaacctgcaaatcttaaacaaatccacgaaagaaaaaatagagcatagg
gtgcaaatctggggcaaagctgccattggtctgtatctctgggaacatatttttgaaggc
actcttgatcctgctgatgtgactgctcagtggagggaaggacagtcagttgtaggaaga
acgcattacagcttcatcacaggcccagctgtagttcctgggtacttctccatagatgtg
gacaatgtggttcttgttttaaatggaagagaaaaagcaaagatctttcatgccacccag
tggttaatttatgcacagaatttaatgaaaacccaaaaactgcagcatctggctgttgtc
ttgcttggaaatgagcactgtgaaaatgactggataatgcagttcctcaaaagaaatgga
ggctttgtggatctgcttttcataacatatgacagcccctggattaatggtgcagacatt
ctccagtggcctttaggtgtagcaacatataggcagtttcctgtagttgaagccagctgg
acaatgctgcatgatgagaggccctacatatgtaatttcttaggaactgcctatgaaaat
tcatcaagacaagcactaatgaacattttgaaacaagatggaaatgataaactttgttgg
gtttctgcaagagaacagtggcagcctcaggagacaaatgaaagccttaagaattaccaa
gatgctttgcttcacagtgatctcacattgtgccctgtaggagtgaacacggaatgttac
aggatctatgaggcctgctcctttggctccattcctgtggtagaagatgtgatgacagct
ggtcactgtggaaacacaaccagtcagcacagtgctcctctgcagttactcaaggccatg
ggggcccccttcatcttcatcaagaactggaaggagcttcctgctattttagaaaaggag
aagactataagcttacaagaaaagattcaaagaagaaaagtgttacttcattggtaccaa
cacttcaaaacagaactaaaatggaaatttactaaaattttagaaagttcattttttatt
aataataaagtttaa

DBGET integrated database retrieval system