KEGG   Mus musculus (mouse): 216440
Entry
216440            CDS       T01002                                 

Gene name
Os9, 4632413K17Rik, AU022351
Definition
(RefSeq) amplified in osteosarcoma
  KO
K10088  protein OS-9
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    216440 (Os9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:mmu04091]
    216440 (Os9)
Lectins [BR:mmu04091]
 P-type lectins
  216440 (Os9)
SSDB
Motif
Pfam: PRKCSH PRKCSH_1 ATG27 RRN3
Other DBs
NCBI-GeneID: 216440
NCBI-ProteinID: NP_001164497
MGI: 1924301
Ensembl: ENSMUSG00000040462
UniProt: Q8K2C7
Position
10; 10 D3
AA seq 672 aa
MAAEVLLSSLLGLLFLGLLLPARLTGGVGSLNLEELSEMRYGIQILPLPVMGGQSQASDV
VVVSSKYKQRYECRLPAGAIHFQREREEETPAYQGPGIPELLSPMRDAPCLLKTKDWWTY
EFCYGRHIQQYHMEDSEIKGDVLYLGHYQSSFNWDDETAKASKQHRLKRYHSQTYGNGSK
CDLNGKPREAEVRFLCDEGAGISGDYIDRVDEPVSCSYVLTIRTSRLCPHPLLRPPASAA
PQAILCHPALQPDEYMAYLQRQAESKQHEEKTTEEVQDTDRQVWSGSKAAGAPPKKEDVS
PAKEEKESELWKLQGPEEQAAAREEAQAGEQDLNHEAAADPAPSPPNDFQNNVQVKLIRS
PADLIRLIEELKAAEKGKPSVRREQPGDDTTEAPQREAEGTKAKGKDGEPPGLMEEEDGD
DEEEEEEEEEDEEEQQLLGEFEKELEGMLLPSNRERLRSEVKAGMERELENIIQETEKEL
DPEGLRKESEREQAILALTSTLDKLIKRLQENQSPELVQKYKKRRVVPQKPPPSPHPTEE
EPEHRVRVRVTKLRPGGPNRDLTVLEMNRENPQLKQIEGLVTEVLEREGLTAEGKIEIKI
VRPGAEGKEEDTRWLTDEDTRNLKEIFFNILVQGAEEANKERQRQSELESNYRRVWGSPG
GEDTGDLDEFDF
NT seq 2019 nt   +upstreamnt  +downstreamnt
atggcggcggaggtgctgctgtccagtctgttgggattgctatttctagggctcctgtta
cctgcgcgtctgacgggcggtgtcgggagcctgaatttggaggagctgagtgagatgcgt
tatggcatccagatcttgccgttgcctgtcatgggagggcagagccaagcttcagacgtg
gtggttgtgtcttcaaagtacaaacagcgctatgagtgccgcctaccagctggagctatt
cacttccaacgtgaaagagaggaggagacgcctgcttaccaggggcccgggatccctgaa
ttgttgagcccaatgagagatgccccttgtttgctgaagaccaaggactggtggacatat
gaattctgttatggacgtcatatccagcagtaccatatggaagactcggagatcaaaggt
gacgtcctctatcttggccactaccagtcctccttcaactgggacgacgaaacagccaag
gcttccaagcagcatcggctgaaacgctaccacagccagacctacggcaacgggtccaaa
tgtgatctcaacgggaagccccgagaagctgaagttcggttcctgtgtgacgagggtgcg
ggcatatctggggactacattgaccgagtagatgaacccgtctcctgctcctacgtactg
accattcgcacgtcaaggctctgcccgcatcctctcctccggccaccagccagcgctgcc
ccacaggccattctttgtcacccagccctgcagcctgatgagtacatggcctacctccag
aggcaagctgagtcaaagcagcatgaagagaaaaccacagaggaagtccaggacacagac
cgccaagtgtggagtgggagcaaggctgccggagcacccccaaagaaagaagatgtcagc
ccagccaaggaagagaaggaatcagagctctggaagcttcaggggccagaggagcaggca
gcagcaagagaggaggcgcaggcaggggaacaggacctgaaccacgaggccgcagcagat
ccagctccaagccctcccaatgattttcagaataacgtgcaggtgaaactcatccggagt
cccgcagacttgattcgactgattgaggagctgaaagctgcagaaaaggggaagccaagc
gtaaggcgggagcagcctggagacgataccacggaggccccccagagggaagcagaggga
acgaaggcgaagggaaaggatggtgagcccccgggtcttatggaagaggaggatggtgac
gacgaagaggaggaggaggaggaggaagaggacgaggaggagcagcagctcctgggagag
ttcgagaaggagctggaggggatgttgctgccctcaaaccgcgagcgcctccgctctgag
gttaaggctggcatggagcgggagctggagaacatcatccaggagacagagaaggaactg
gacccagaagggctgaggaaggagtccgagcgggagcaggcaatattggctctaacatcc
actctggacaaactcatcaagaggctgcaggagaaccagagtccagagcttgtgcaaaaa
tacaaaaaaaggagagttgtcccccaaaagcctcccccatcaccacaccctacagaggag
gaacctgagcacagagtccgggtccgagtcaccaagctccgtcctggaggccccaatcgg
gacctgactgtcctggagatgaaccgggaaaacccacagctgaaacagatcgaggggctg
gtgacagaagtgctggagagggaggggctcacggcggaaggcaagattgagatcaagatt
gtgcgacccggggctgaaggtaaggaagaggacacacgctggctgactgatgaggataca
agaaaccttaaggagattttcttcaatatcttggtacagggagccgaagaggccaataaa
gagcgccagcgacagagtgagctggagagcaactaccgccgggtgtggggctctcccggt
ggtgaagacacgggggacctggatgaatttgacttctga

DBGET integrated database retrieval system