KEGG   Mus musculus (mouse): 216443Help
Entry
216443            CDS       T01002                                 

Gene name
Mars, Metrs, Mtrns
Definition
(RefSeq) methionine-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00450  Selenocompound metabolism
mmu00970  Aminoacyl-tRNA biosynthesis
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    216443 (Mars)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    216443 (Mars)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mmu01007]
    216443 (Mars)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmu03016]
    216443 (Mars)
Enzymes [BR:mmu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     216443 (Mars)
Amino acid related enzymes [BR:mmu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   216443 (Mars)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    216443 (Mars)
 Prokaryotic type
   Other AARSs
    216443 (Mars)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g GST_N_5 WHEP-TRS tRNA-synt_1 GST_C GST_C_2 Anticodon_1 GST_C_3 DUF16
Motif
Other DBs
NCBI-GeneID: 216443
NCBI-ProteinID: NP_001003913
MGI: 1345633
Ensembl: ENSMUSG00000040354
Vega: OTTMUSG00000032541
UniProt: Q68FL6
Position
10; 10 D3
AA seq 902 aa AA seqDB search
MRLFVSEGSPGSLPVLAAAARARGRAELLISTVGPEECVVPFLTRPKVPVLQLDSGNYLF
SASAICRYFFLLCGWEQDDLTNQWLEWEATELQPVLSAALHCLVVQGKKGEDILGPLRRV
LTHIDHSLSRQNCPFLAGDTESLADIVLWGALYPLLQDPAYLPEELGALQSWFQTLSTQE
PCQRAAETVLKQQGVLALRLYLQKQPQPQPPPPEGRTVSNELEEEELATLSEEDIVTAVA
AWEKGLESLPPLKLQQHPVLPVPGERNVLITSALPYVNNVPHLGNIIGCVLSADVFARYC
RLRQWNTLYLCGTDEYGTATETKAMEEGLTPREICDKYHAIHADIYRWFGISFDTFGRTT
TPQQTKITQDIFQRLLTRGFVLRDTVEQLRCERCARFLADRFVEGVCPFCGYEEARGDQC
DRCGKLINAIELKKPQCKICRSCPVVRSSQHLFLDLPKLEKRLEDWLGKTVPGSDWTPNA
RFIIRSWLRDGLKPRCITRDLKWGTPVPLEGFEDKVFYVWFDATIGYVSITANYTDQWEK
WWKNPEQVDLYQFMAKDNVPFHGLVFPCSVLGAEDNYTLVKHIIATEYLNYEDGKFSKSR
GIGVFGDMAKDTGIPADIWRFYLLYIRPEGQDSAFSWTDLLIKNNSELLNNLGNFINRAG
MFVSKFFGGCVPEMALTPDDRRLVAHVSWELQHYHQLLEKVRIRDALRSILTISRHGNQY
IQVNEPWKRIKGGEMDRQRAGTVTGMAVNMAALLSVMLQPYMPTVSSTIQTQLQLPPAAC
RILATSFICTLPAGHRIGTVSPLFQKLENDQIENLRQRFGGGQAKGSPKPAAVEAVTAAG
SQHIQTLTDEVTKQGNVVRELKAQKADKNQVAAEVAKLLDLKKQLALAEGKPIETPKGKK
KK
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgagactgttcgtgagcgagggttccccggggagcctgcccgtgctggctgcggccgcg
agggcccggggtcgggcggagctgctcatcagcaccgtaggccccgaagagtgtgtggta
ccattccttacccggcctaaggtccctgtcttgcagctggatagtggcaactacctcttc
tctgctagtgcaatctgccgatatttttttctgttatgtggctgggaacaagatgatctc
accaaccagtggctggaatgggaggcaacagaactgcagccagttctgtctgctgcccta
cactgtctagtggttcaaggcaagaaaggggaagatatacttggcccacttcggagagtc
ctgactcacattgatcacagcttgagtcgtcaaaactgtcctttcctggctggggacaca
gaatctctagctgacattgttttgtggggagcactgtatcctttactgcaagacccagct
tacctccctgaggagttgggtgccctgcaaagttggttccagacactgagtacccaggaa
ccgtgtcagcgagctgcagagacggtgctaaaacagcagggtgtcctggcacttcgtctg
tacctccagaaacagccacagcctcagcccccgcctcctgaggggagaactgtcagcaac
gagctggaggaagaggaactggctaccttgtctgaggaggacatcgttacagctgttgcc
gcgtgggagaagggtctggaaagcctgcctccgctaaagctccagcagcatccagtgttg
cctgtgcctggagagaggaatgttctcatcaccagtgccctcccctatgtcaacaatgtc
ccccaccttggaaacatcattggctgtgtgctcagtgctgatgtctttgcaaggtattgt
cgccttcgccagtggaataccctctatctgtgtggtacagatgagtatggtactgcgaca
gagaccaaggccatggaggagggcctaaccccacgggaaatctgtgacaagtaccatgcc
atccatgctgacatctaccgctggttcggcatatcgttcgatactttcgggcgcactacc
actcctcagcagaccaaaatcacccaggacatcttccagaggttgctgacccgggggttt
gtgctgcgagatactgtggagcagcttcggtgtgagcggtgtgcacgtttcctggctgac
cgctttgtggagggtgtgtgtcccttctgtggctatgaagaggcccgaggtgaccagtgt
gacaggtgtggcaagctcatcaatgccattgagctcaagaaaccacagtgcaaaatctgc
cgctcctgccctgtggtgaggtcctcacagcacctgtttctagacttgcctaagttggaa
aagcgtctggaggactggttggggaagacagtgcctggcagtgactggacacccaatgcc
aggttcattatacgttcctggcttcgagatggcctcaagccacgatgcatcaccagagac
ctcaaatggggaacgcctgtgcccttggaaggttttgaggacaaggtattttacgtctgg
tttgatgctactattggctacgtgtccatcacagccaactacacagaccaatgggagaaa
tggtggaagaacccagaacaagtggacctttaccagttcatggccaaagacaatgttccc
ttccatggcttggtctttccgtgttcagtcctaggagctgaggacaactacaccctggtc
aagcacatcattgctacagagtacctgaactatgaggatgggaaattctctaagagccgg
ggcataggagtgtttggagacatggccaaggatacaggaatccctgctgacatctggcga
ttctatctgctatacattcggcctgagggccaggacagtgccttctcctggacagacttg
ttgattaaaaacaattctgagctgctcaacaacctgggcaacttcatcaacagagctggc
atgtttgtttctaagttttttggcggttgtgtgcctgagatggcgctaacccctgatgac
agacgcctggtggcccatgtctcttgggaactccagcactatcaccagctgttggaaaag
gttcggatccgggatgccttgcgcagtatcctcaccatatctcgccatggcaaccaatac
attcaagtgaatgagccctggaaacggattaaaggtggtgagatggacaggcagcgggca
ggcacagtgacaggcatggcagtgaacatggctgccttgctgtctgtcatgctgcagcca
tacatgcccacagtcagctctaccatccagacccagctgcagctcccacctgcagcctgc
cgcatccttgccacaagcttcatttgtaccttgccagcaggccaccgaattggcacagtc
agtcctttgttccaaaaactggaaaatgaccagattgaaaatttgaggcagcgctttgga
gggggtcaggctaaaggctcccccaagccagcagctgtggaggcagttacagcagcaggc
tcgcagcacatacaaacgctgacggatgaggtgaccaagcagggcaacgtcgtccgggaa
ctgaaagcacagaaggcagacaagaaccaggttgctgcagaggtggctaaactcttggat
ctaaagaaacagttggctttggctgaggggaaacccattgaaactcctaaaggcaagaag
aaaaagtga

DBGET integrated database retrieval system