KEGG   Mus musculus (mouse): 216445Help
Entry
216445            CDS       T01002                                 

Gene name
Arhgap9, AU043488
Definition
(RefSeq) Rho GTPase activating protein 9
  KO
K20634  Rho GTPase-activating protein 9
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    216445 (Arhgap9)
Membrane trafficking [BR:mmu04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    216445 (Arhgap9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGAP PH SH3_9 SH3_1 PH_9 GHMP_kinases_C
Motif
Other DBs
NCBI-GeneID: 216445
NCBI-ProteinID: NP_001272714
MGI: 2143764
Ensembl: ENSMUSG00000040345
UniProt: Q1HDU4
Position
10; 10 D3
AA seq 648 aa AA seqDB search
MFSGRWWPSIWGNLGLSLQSPSQGPQLCALYPFTYTGADGRQVSLAEGDRFLLLRKTNSD
WWLARRLGAPPSSRPIFVPAAYMTEESICCHNPADTTYNSSLWTPGTKLYHGSLEELYLP
QEPQVASGQPLHHPHKMCKSVSTGNVKACSLKSFKEGPGERSHWWMTEVAVKPGSMEQTE
TLTRDSSALQPQEWLDPQGLPSLSQSVPWLALSEQPGALRPCSALPQLLDDPHVEERSGL
LNMTKIAQGGRKLRKNWGPAWVVLTGSSLVFYRERPPQSASLQGWARAGSRPESSVDLRG
AALASGRQLSSRRNVLHIRTVPGHEFLLQSDEETELRDWHRALRTVIERLDRENPLELRL
SGSGPAELAELSAGEDDELESEPVSKSLMRLGSRRTSSRCAEGTDQKNRVRNKLKRLIAK
RPTLQSLQERGLFRDQVFGCQLESLCQREGDTVPSFVRLCVEAVDKKGLDVDGIYRVSGN
LAVVQKLRFLVDRERAVTSDGRYMFPEQAGQEGKLDLDSAEWDDIHVVTGALKLFFRELP
QPLVPALLLPDFRDALELSEPEQCLSKIQKLIDSLPRPNHDTLKYILEHLCRVIAHSDKN
RMTAHNLGIVFGPTLFRPEQEASDMAAHVFYPGQLVQLMLNNFASLFT
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgttctcaggccggtggtggccaagtatctggggaaatctagggctgagtctacaaagc
ccttctcagggaccccagctctgcgccctctatccgttcacttacactggggcagatggc
cggcaggtgtctctggctgaaggtgacaggttcctactgcttcgaaagaccaactcagac
tggtggctggcgaggcgtctgggcgcaccccccagctctcggcccatctttgttccagct
gcatacatgacagaggaatcaatctgctgccacaacccagcagacactacctacaacagc
tccctctggactcctgggacaaagctgtatcatggctccctggaggagctctatctgcct
caggaaccccaggttgcttctgggcagcctcttcaccatccccacaagatgtgcaaaagt
gtcagcacgggcaatgtgaaggcctgctccctgaaatccttcaaggaagggccaggagaa
aggtctcactggtggatgacagaagttgctgtgaaaccgggctccatggagcagacagag
actttgactagggacagcagtgccctacagcctcaggaatggctcgatccacagggttta
ccaagcctcagccaaagcgtcccatggcttgctctctctgaacagccgggagccttgagg
ccctgttcagctctgccacagctcctggatgacccccacgtggaagaaaggtcaggcctg
ctcaacatgaccaagattgctcaaggagggcgcaaactcaggaagaactggggccctgct
tgggtggtgttaactggtagcagccttgtgttttaccgagagcggccaccgcagtctgca
tccctccaaggctgggcgcgggctgggagccggccggagagtagcgtggacctgcgcggg
gcggccctggccagcgggcgccagctgtccagccgccggaacgtcctgcacatccgcacg
gtcccgggacatgagttcctgctgcagtcggacgaggagaccgagctgcgagactggcac
cgcgcgctgcggactgtcatcgagcggctggatcgggagaaccccctggagctgcgtctg
tcgggctccggacccgccgagctggccgagctgagcgctggtgaggatgacgaattggaa
tcggaaccggtgtccaagtccctgatgcggcttggcagccgcagaacttccagtcggtgt
gcagagggcactgaccagaagaaccgcgtgcggaacaagttaaagcggctaatcgccaag
agaccaaccttgcagagcctacaagagcggggtctgttccgagaccaggtttttggctgc
cagttggagtcgctgtgccaacgggaaggggacaccgtgcccagctttgtccggctttgt
gttgaggccgtggataaaaaaggtctagacgtggatggtatttaccgggtgagtgggaac
ctggccgtggtccagaaactccgcttcctggtagacagagaacgggcagtgacctctgat
gggagatacatgttcccagaacaggcaggacaagaaggcaaattagatttagacagtgcc
gaatgggatgatattcacgtggtcaccggagctttgaagctttttttccgggagctgcca
cagcctctggtgcctgcattgttgctgcctgactttcgtgatgcccttgaactttctgag
ccagagcagtgcctctccaaaatccagaaattaatagactcgctgccgaggcccaaccat
gacactctgaagtacatcctggagcatctgtgcagggtgatagcacactcggataagaac
cgaatgaccgcccacaacctgggaattgtgtttggaccgacactgtttcgacctgagcag
gaggcctctgacatggcggcccacgtattctaccccgggcagctggtccagttgatgctc
aacaactttgccagcctcttcacttga

DBGET integrated database retrieval system