KEGG   Mus musculus (mouse): 21645
Entry
21645             CDS       T01002                                 

Gene name
Tcte1, D17Sil1, Tcte-1
Definition
(RefSeq) t-complex-associated testis expressed 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: LRR_6 LRR_4 LRR_8
Other DBs
NCBI-GeneID: 21645
NCBI-ProteinID: NP_038716
MGI: 98640
Ensembl: ENSMUSG00000023949
UniProt: A6H639
Position
17 B3; 17 22.54 cM
AA seq 498 aa
MQETPSVPSNSSSHSQSVLTIQRQVSALGSSSTGPTSLKTSSTPTPGQLKTKVPNVRRMR
RIISEDAEWSLAIVPLLTELCIQHIVKNFQNNPILKQLPLEHQKKVLSNLPPELPLTVTA
NLIDDENYWHRCCIKRWSVCHVSRHGGSWKRMFFERHLENLLKLFIPGTTDPNVILDLLP
LCRNYVRRIHVDQFLPPVRMPTPLQGEEQSDSGSEGEGSEPEKDHYQLQTLVGGLKHLEE
LDLVYGVKDCGMNFEWNLFLFTYRDCYSLAATIKACHTLKIFKLTRSKVDDDKARILIRS
LLDHPALEELDLSHNLIGDRGARAAAKLLSHSRLRVLNLANNQLQAPGAQSLAHALAHNT
NLVFLNLRLNCIEDEGGQAIAHALETNKCLSVLHLGGNKLSEPTATLLSQMLTVNTTLVS
LNLSCNHIGQDGGKQLLEGISDNKTILEFDLRLSDVSQESEYLIGQVLHANREAARQRTL
NPGHFSSPTNNCTENSVV
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgcaggaaaccccatcagtaccgtccaactcttcgtctcacagccagtcggttctcacc
atccagcgccaggtctctgccttgggcagctccagcacaggacccacgtccttgaagacc
agcagcacccctaccccaggccagctgaagaccaaggtcccaaatgtccgtcgcatgcgc
aggatcatctccgaggatgcagagtggtcactggccatcgtacctctccttacagaactc
tgcattcaacatatcgtcaagaacttccagaacaaccctatcctgaagcagctgccgcta
gagcaccaaaagaaggtcttgagcaacctgccccccgagctgcctttgacggtgaccgct
aacttgattgacgatgagaattactggcaccgctgctgcatcaagcgctggtccgtgtgc
cacgtgtccaggcacggcggcagctggaagcgtatgttcttcgagagacacctggagaac
ctgctgaagctattcatcccggggaccacggaccccaacgtgatcctggacctgctgccc
ctctgcaggaactacgtgcgccgcattcatgtggaccagttcctcccacctgtgcggatg
ccgaccccgctccagggagaggaacagtcggactctggcagtgagggcgaggggagcgag
ccagagaaggaccactaccagctgcagacgctggtgggtggcctcaaacacctggaggag
ctggacctggtgtacggcgtcaaagactgtggcatgaattttgagtggaacctctttctc
ttcacctaccgagactgctactctctggcagccaccatcaaagcttgccacaccctcaag
atcttcaagctgacccgaagtaaggtggacgacgataaggcgcgcatcctaatccgtagc
ctgctggaccacccagccctggaggagctggacttatcccacaacctcatcggagaccgt
ggtgcacgagcagcggctaagctgctgagccacagtcgcctgagagtgctcaacctggcc
aacaatcaactgcaggcgcctggcgcacagtcactggctcacgcactggcacacaacacc
aacctggtcttcctcaacctccgcctcaactgtatcgaggacgagggtggccaagcaatc
gcccacgccctggagaccaacaagtgcctctccgtgctgcaccttggtggcaacaagctg
tctgagcccacagccacactcctctcccagatgctcactgtcaacactacgctcgtcagc
ctcaacctatcctgcaaccacattgggcaggatggtgggaagcaactcctggaaggcata
tcagacaacaagaccattctagagttcgacctgcgactgtcagatgtatcccaggagagc
gagtacctcattggccaggttctgcatgccaaccgagaggctgcccgccagcggaccctg
aatcctggccacttctcctcacccactaacaactgtactgagaattctgtagtctaa

DBGET integrated database retrieval system