KEGG   Mus musculus (house mouse): 21652
Entry
21652             CDS       T01002                                 
Symbol
Phf1, D17Ertd455e, Pcl1, Phf2, Tctex3
Name
(RefSeq) PHD finger protein 1
  KO
K11467  PHD finger protein 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    21652 (Phf1)
   03036 Chromosome and associated proteins [BR:mmu03036]
    21652 (Phf1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Other zinc fingers
    21652 (Phf1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    Other polycomb group proteins
     21652 (Phf1)
SSDB
Motif
Pfam: Tudor_2 PHD Mtf2_C PHD_2 DUF4537 Chromo C1_1
Other DBs
NCBI-GeneID: 21652
NCBI-ProteinID: NP_033369
MGI: 98647
Ensembl: ENSMUSG00000024193
UniProt: Q9Z1B8
Structure
Position
17:27152101..27156882
AA seq 559 aa
MAQLPRLSRLGAPSLWDPASPAPTSGPRPRLWEGQDVLARWTDGLLYLGTIKKVDSAREV
CLVQFEDDSQFLVLWKDISPAALPGEELLCCVCRSETVVPGNRLVSCEKCRHAYHQDCHV
PRAPAPGEGEGASWVCRQCVFAIATKRGGALKKGPYARAMLGMKLSLPYGLKGLDWDAGH
LSNRQQSYCYCGGPGEWNLKMLQCRSCLQWFHEACTQCLSKPLLYGDRFYEFECCVCRGG
PEKVRRLQLRWVDVAHLVLYHLSVCCKKKYFDFDREILPFTSENWDSLLLGELSDTPKGE
RSSQLLSALNSHKDRFISGREIKKRKCLFGLHARTPPPVELLTGDGAPTSFPSGQGPGGG
VSRPLGKRWRSEPEPLRRRQKGKVEELGPPTAAHSRHGSREQRALQASVSPPPPSPNQSY
EGSSGYNFRPTDARCLPSSPIRMFASFHPSASTAGTSGDSEPPDRSPLGLHIGFPTDTPK
SSPHSVTASSSSVPALTPGFSRHSPPSPLCRSLSPGTGGGVRGGVSYLSRGDPVRVLARR
VRPDGSVQYLVEWGGGGIF
NT seq 1680 nt   +upstreamnt  +downstreamnt
atggcgcagctcccccggctgagccgtttgggtgccccctctctctgggatccagcttcc
cctgctcccacctcaggccccagacctcggctttgggaaggccaagatgtgctggccaga
tggactgatgggctgctgtacttgggtaccatcaaaaaggtggacagtgctcgagaggtg
tgtctggtccagtttgaggacgattcccagtttctggttctatggaaggatatcagccca
gctgccctccctggggaggagctgctctgttgtgtgtgtcgctctgagaccgtggtacct
gggaaccggctggtcagctgtgagaagtgtcgccatgcttatcaccaggactgtcacgtt
cccagggccccggcccctggagaaggagagggcgcatcctgggtatgccgccagtgtgtc
tttgcaatcgccactaagaggggaggcgcactgaagaaaggtccctatgcccgggccatg
ctgggcatgaagctctccctgccatacggattaaaagggctggactgggatgctggacat
ttgagcaacagacagcagagctactgctactgtggaggccctggagagtggaacctgaaa
atgctgcagtgccggagctgcctccagtggttccatgaggcctgcacccagtgtctgagc
aagcccctcctctacggagacagattctatgaatttgagtgctgtgtgtgccggggcggc
cctgagaaggtccggaggttacagcttcgctgggtggatgtggcccatcttgtcctctac
cacctcagcgtttgctgtaagaagaaatattttgattttgaccgagagatcctccccttc
acctctgagaattgggacagtctgctcctgggggagctctcagatactcccaagggagag
cgctcttcccagctcctttctgctcttaacagccacaaggaccgtttcatttcagggagg
gagattaaaaagcgaaaatgtctttttggtctccatgctcggacccctcctcctgtggag
cttctcactggagatggagcccccaccagcttcccttcagggcagggccctgggggaggg
gtctcacgtcccctggggaaacgatggaggtcggagccagaacccttaaggaggaggcag
aaggggaaagtggaggaactggggccacccacggcagcacacagtcggcatgggtcccgg
gagcagagggccctgcaggcctcggtgtctccaccaccccccagccctaaccagagctat
gagggcagcagcggctacaacttccggcccacagacgcccgctgtctgcccagcagccct
atccggatgttcgcctccttccacccttctgccagcactgcagggacctctggggacagt
gaacccccagataggtcacctctgggacttcacattggcttccccacagacacccctaaa
agttcaccccactcagtgacggcctcatcttcctcggtcccagccctgaccccaggcttt
tccagacattcacccccttctcccttgtgccgtagtctgtctccggggactgggggagga
gtccgaggtggggttagctacctgtcccgaggggaccctgtgagggtccttgctcgaaga
gtgcggcctgacggctctgtgcagtacctagttgagtggggaggggggggcatcttctga

DBGET integrated database retrieval system