KEGG   Mus musculus (mouse): 216549
Entry
216549            CDS       T01002                                 

Symbol
Aftph
Name
(RefSeq) aftiphilin
  KO
K25218  aftiphilin
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    216549 (Aftph)
Membrane trafficking [BR:mmu04131]
 Endosome - Golgi transport
  Others
   Aftiphilin/p200/gamma-synergin complex
    216549 (Aftph)
SSDB
Motif
Pfam: Clathrin_bdg polyprenyl_synt
Other DBs
NCBI-GeneID: 216549
NCBI-ProteinID: NP_001277474
MGI: 1923012
Ensembl: ENSMUSG00000049659
Vega: OTTMUSG00000005232
UniProt: Q80WT5
Position
11; 11 A3.1
AA seq 931 aa
MEPDIIRMYSSSPPPLDNGAEDDEEDEFGEFGGFSEVSPSGVGFVDFDTPDYTRPKEDFV
PSNHFMPIHEYSEDVDSLTSFKSVQNGNDKDITAELSTPVKSQSDVVLSTTSKEMIPSKT
LDPSIDGMESLEDLDKVVVQGPSTGQLRSFSPGDFRTDKNIVHQTKQLESCNGEKPPCLE
ILTNGFAGLETVNPQGTDDLDNVADSKGSKPLNTCGTECILESAASHATEFADFSTFSQT
ERTQLEEIECPVLNDGDTLTIQGNSKGPRVKELNCVKEVTLDGSFEDTGNTEREHQVCVS
EIHAVADRGLSVEKQDLQTLQQDEFLNSRIQSEAWSLVDSSENSEAITKERCKMEKNDLF
ASKCADLSMDSVKTSDVNEIGSSKEENRKLTNPKSPDPDPTGQNALDDSAASMKNGDSGN
GFVTCHDTNEDDFGDFGTANGTTPPFVTSTQDSMSDVTFEDSSEHFLHLSEPGDDFGEFE
DTNAVSCQEEMRFTESDLRQTSDGLSEECPLAGESGGKDSKPDSKLKNGQDSEFGDFDSV
PNTQGSAFQDSDDFADFSSAGPSQAVDWNAFEDEQKDGCSWAAFGDQQETESHHLKEVWQ
SQRTDETMGTLGTPKMHSVSSAASKGAVASGHLQEPGTSVQTALLNRLERIFEACFPSVF
VPDVEEEVSSLKHLLETHSSPAKTREALADRGELRGVWTELQDIHDAHGLRYQWGGSHSN
KKLLCSLGIDTRNILFTGNKKQPVIVPMYAAGLGMLEPTKEPLKPLSAAEKIASIGQTTV
MTPEINTCTSDPFQESLPPVQFDWSSSGLTNPLDASGGSTLLNLDFFGPVDDSSSSSSTI
PGVDPELYELTTAKLETSTSSLRVTDAFAKLMSTVEKTSTSTRKPKREEHLSEEAMKVIA
SLPDLTFMHAKVLMFPATLTPSMSSQEQADA
NT seq 2796 nt   +upstreamnt  +downstreamnt
atggagccagacatcattcgaatgtactcttcctcccccccacctctagacaacggagca
gaggatgatgaggaggatgagtttggggagtttggtgggttttcggaagtcagcccttct
ggtgtagggtttgttgattttgacacaccagattatactcgtcccaaggaagactttgta
ccttcaaaccactttatgccaattcatgaatattcagaagatgtagatagccttacaagc
tttaagtctgttcagaatggtaatgataaggatatcactgctgaactttctactcctgtg
aaaagtcaatctgatgttgtactttctaccaccagcaaagaaatgattccatctaaaact
ttggatccttccatcgatggtatggaaagcctggaagacttagataaagtagtggtgcag
ggaccaagcactgggcaactcagaagtttctctcctggagattttagaactgataagaac
attgttcaccaaaccaagcagttagagagctgcaacggtgaaaagcctccttgtctggaa
attctaacaaacgggtttgcaggtttggaaactgtaaatcctcagggaacagatgacctg
gacaatgtggcagattcaaagggatcgaagcctcttaacacttgtggcaccgagtgcatt
ttagagtctgcagctagtcatgctacggaatttgcagatttttctacattttcccaaaca
gaaaggacacaactggaagaaatagaatgtccagttttaaatgatggtgatacactgacc
attcagggaaacagcaaaggccccagagtcaaggaactaaactgtgtgaaagaagtgact
ttggatggaagctttgaggatacggggaacactgaaagagaacatcaggtctgcgtctca
gaaatccatgccgtagctgacagagggctcagtgttgaaaaacaagaccttcaaacactg
caacaggatgagtttctaaattcaaggattcagtctgaggcttggagcttggtagactca
agtgaaaattcagaagccattacaaaggagcggtgtaaaatggaaaaaaatgacttattt
gcctctaagtgtgctgacttatccatggattctgttaaaacttcagacgttaatgaaatt
ggttcttccaaagaagaaaacagaaagctgactaatcccaaaagcccagaccctgatccc
acaggacaaaatgctttggatgattctgctgcaagcatgaaaaatggtgacagtgggaat
ggctttgtgacttgtcatgataccaatgaggatgattttggtgactttggtacagccaat
ggcaccactccaccctttgttactagtactcaagattcaatgagtgacgtcacttttgaa
gactcctcagagcattttctacatcttagtgaaccaggtgatgattttggagaatttgag
gatacaaatgctgtttcttgtcaagaggaaatgagatttactgagtcagacctaagacag
acttctgatggcttatcagaggaatgtccattggcaggagagtctggtggaaaagacagt
aaacctgactcaaaactgaaaaatggtcaagacagtgaatttggagattttgattctgtg
ccaaatactcaaggtagtgcttttcaagactcggatgattttgcagacttcagttcagca
ggtcctagccaagctgtagattggaatgcttttgaggatgaacagaaagatggttgttct
tgggctgcctttggggatcagcaggagactgagtctcatcatctaaaggaagtctggcag
tcacagaggacagatgaaactatgggcactctgggaacccctaagatgcacagtgtttct
tcagcagcttccaaaggagcagttgctagtggccatttgcaggaaccaggcacttcagtt
cagacagctttactcaaccggttggagagaattttcgaagcctgttttccgtctgtgttt
gtccctgatgtggaagaggaggtttcttccctgaagcacttgctggagacacacagctcg
ccagcaaaaacaagagaggccttagctgaccgtggtgagttgaggggtgtatggaccgaa
ctgcaggacatccatgatgcacatggtttgcggtaccagtggggtggctcacatagcaac
aagaagcttttgtgctccttgggaatagacactcgaaacattctattcactggcaataag
aagcaacctgttatagtgcccatgtatgcagcaggattgggaatgttagagcccaccaag
gaaccattaaaaccactatctgctgcagaaaaaattgcttctattggtcagacaaccgtt
atgacaccagaaataaacacgtgtacatctgatccattccaggagtctctcccacctgtc
cagtttgactggagtagcagtggccttactaaccctttagatgctagtggaggttccact
ctcctgaaccttgatttctttgggcccgtggatgacagtagctctagcagcagcacaatc
ccaggtgtggatccagagttgtatgagttaacaactgctaagctggagacctccacctca
agcctcagagtgactgatgcatttgcgaagctcatgtctacagtggaaaagacaagcacg
tcaaccaggaaaccaaaaagagaggagcacctgagtgaggaagccatgaaggtgatcgcc
agccttccagacctgaccttcatgcatgccaaggtgttgatgttcccagccactctgaca
ccttccatgagctcccaagaacaagcagacgcgtag

DBGET integrated database retrieval system