KEGG   Mus musculus (mouse): 216643
Entry
216643            CDS       T01002                                 

Gene name
Gabrp
Definition
(RefSeq) gamma-aminobutyric acid (GABA) A receptor, pi
  KO
K05189  gamma-aminobutyric acid receptor subunit pi
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04723  Retrograde endocannabinoid signaling
mmu04727  GABAergic synapse
mmu05032  Morphine addiction
mmu05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    216643 (Gabrp)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    216643 (Gabrp)
   04723 Retrograde endocannabinoid signaling
    216643 (Gabrp)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    216643 (Gabrp)
   05033 Nicotine addiction
    216643 (Gabrp)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    216643 (Gabrp)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  GABA-A
   216643 (Gabrp)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 216643
NCBI-ProteinID: NP_666129
MGI: 2387597
Ensembl: ENSMUSG00000020159
Vega: OTTMUSG00000006342
UniProt: Q8QZW7
Position
11; 11 A4
AA seq 440 aa
MSYSLYLAFLCLSLLTQRTCIQGNQVNVEVSRSDKLSLPGFENLTAGYNKFLRPNFGGDP
VRIALTLDIASISSISESNMDYTATIYLRQRWTDPRLVFEGNKSFTLDARLVEFLWVPDT
YIVESKKSFLHEVTVGNRLIRLFSNGTVLYALRITTTVTCNMDLSKYPMDTQTCKLQLES
WGYDGNDVEFSWLRGNDSVRGLENLRLAQYTIQQYFTLVTVSQQETGNYTRLVLQFELRR
NVLYFILETYVPSTFLVVLSWVSFWISLDSVPARTCIGVTTVLSMTTLMIGSRTSLPNTN
CFIKAIDVYLGICFSFVFGALLEYAVAHYSSLQQMAVKDRGPAKDSEEVNITNIINSSIS
SFKRKISFASIEISGDNVNYSDLTMKASDKFKFVFREKISRIIDYFTIQNPSNVDRYSKL
LFPLIFMLANVFYWAYYMYF
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgagctacagcctctatttggccttcctgtgtctgagtctcctcactcagaggacgtgc
atccaggggaaccaggtcaatgtggaggtcagcagaagtgacaagctttccttacctggc
tttgagaacctcactgcaggatataacaaattcctcaggcccaatttcggtggtgaccca
gttcggatagcactgactctggacatcgccagcatctctagcatctcagagagtaacatg
gactacacagccactatatacctccggcagcgttggacagacccacggctagtgttcgaa
ggcaacaagagctttactctagatgcccgccttgtggagttcctctgggtgccagacact
tacattgtagagtccaagaagtccttcctccatgaagtcacagtgggaaacaggctcatc
cgcctcttctccaacggcacagtcctgtacgcacttagaatcacaacaacagttacatgt
aacatggatctgtctaaataccccatggacacacagacctgcaagctgcagctagaaagt
tggggatacgatggcaatgatgtggagttctcctggctgagagggaatgactcggtgcgt
ggacttgaaaacctgcgccttgctcagtacacaatccaacagtatttcaccctggtcacc
gtatcccagcaggagacaggaaactatacgagattggttttgcaatttgagcttcggagg
aacgtcctgtatttcattctggaaacctatgtcccttccaccttcctggtggtgttatcc
tgggtctccttttggatctccctcgattcagttcctgcgagaacctgcattggagtgaca
acggtgttatccatgacaacgctgatgatcggctcccgcacatccctacccaacaccaac
tgcttcataaaggccatcgatgtgtacctaggcatctgcttcagcttcgtgtttggggcc
ttactggagtatgcagttgctcactacagctccttacagcagatggcagtcaaagatagg
gggccagcgaaggactcggaagaagtcaatatcaccaacatcatcaacagctccatctcc
agctttaaacggaagattagctttgccagcattgaaatctctggtgacaatgtcaactat
agtgacttgacaatgaaagccagcgacaagtttaagtttgtcttccgagagaagatcagc
agaatcattgattatttcacaattcaaaaccccagcaatgtggatcgatactccaaacta
ctatttcctttgatttttatgttggccaatgtattttactgggcatactacatgtatttt
tga

DBGET integrated database retrieval system