KEGG   Mus musculus (mouse): 21667Help
Entry
21667             CDS       T01002                                 

Gene name
Tdgf1, CR1, cripto
Definition
(RefSeq) teratocarcinoma-derived growth factor 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: CFC EGF_2 EGF hEGF
Motif
Other DBs
NCBI-GeneID: 21667
NCBI-ProteinID: NP_035692
MGI: 98658
Ensembl: ENSMUSG00000032494
Vega: OTTMUSG00000052499
UniProt: Q7TQ06 Q3UZP8
Structure
PDB: 

Position
9 F2; 9 60.79 cM
AA seq 171 aa AA seqDB search
MGYFSSSVVLLVAISSAFEFGPVAGRDLAIRDNSIWDQKEPAVRDRSFQFVPSVGIQNSK
SLNKTCCLNGGTCILGSFCACPPSFYGRNCEHDVRKEHCGSILHGTWLPKKCSLCRCWHG
QLHCLPQTFLPGCDGHVMDQDLKASGTPCQTPSVTTTFMLAGACLFLDMKV
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggggtacttctcatccagtgtggttttgcttgtggccatttccagtgcgtttgaattt
ggacccgttgctgggagagaccttgccatcagagataacagcatttgggaccagaaagaa
cctgccgtacgcgatcggtctttccagtttgtgccttccgtggggatacagaacagtaag
tcgcttaataaaacttgctgtctgaatggagggacttgcatcctggggtccttctgtgcc
tgccctccttccttctatggacgcaactgtgaacatgatgttcgcaaagagcactgtggg
tctatcctccatggcacctggctgcccaagaagtgttccctgtgcagatgctggcacggc
cagctccactgtcttcctcagacctttctacctggctgtgatggtcacgtgatggaccag
gacctcaaagcatccgggactccgtgtcaaacgccgtctgtgacgaccacttttatgcta
gctggcgcctgcctttttctagatatgaaagtatag

DBGET integrated database retrieval system