KEGG   Mus musculus (mouse): 216742Help
Entry
216742            CDS       T01002                                 

Gene name
Fnip1, A730024A03Rik, AI838773, AW557298
Definition
(RefSeq) folliculin interacting protein 1
  KO
K20400  folliculin-interacting protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    216742 (Fnip1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FNIP_M FNIP_C FNIP_N
Motif
Other DBs
NCBI-GeneID: 216742
NCBI-ProteinID: NP_776114
MGI: 2444668
Ensembl: ENSMUSG00000035992
Vega: OTTMUSG00000005671
UniProt: Q68FD7
Position
11; 11 B1.3
AA seq 1165 aa AA seqDB search
MAPTLFQKLFSKRSGLGAPGRDARDPDCAFSWPLPEFDPSQIRLIVYQDCERRGRNVLFD
SSVKRKNEDTSVSKLCNDAQVKVFGKCCQLKPGGDSSSSLDSSITLSSDGKDQCPKYQGS
RCSSDANMLGEMMFGSVAMSYKGSTLKIHQIRSPPQLMLSKVFTARTGSSICGSLNTLQD
SLEFINQDSNTLKADSSTVSNGLLGNIGLSQFCSPRRAFSEQGPLRLIRSASFFAVHSNP
MDMPGRELNEDRDSGIARSASLSSLFITPFPSPNSSLTRSCASSYQRRWRRSQTTSLENG
VFPRWSVEESFNLSDESCGPNPGIVRKKKIAIGVIFSLSKDEDENNKFNEFFFSHFPLFE
SHMNKLKSAIEQAMKMSRRSADASQRSLAYNRILDALTEFRTTICNLYTMPRIGEPVWLT
MMSGTPEKNQLCHRFMKEFTFLMENASKNQFLPALITAVLTNHLAWVPTVMPNGQPPIKI
FLEKHSSQSVGMLAKTHPYNPLWAQLGDLYGAIGSPVRLARTVVVGKRQDLVQRLLYFLT
YFIRCSELQETHLLENGEDEAIVMPGTVITTTLEKGEIEESEYVLITMHRNKSSLLFKES
EETRTPNCNCKYCSHPVLGQNTENVSQPEREDTQDNSKELLGISDECQKISPPDCQEENA
VDVQQYRDKLRTCLDTKLETVVCTGSAPADKCVLSETCLEPREESWQNKELLDSDNHTGT
AMRPTGIVVEKKPPDKNVPSAFSCEVTQTKVTFLIGDSMSPDSDTELRSQAVVDQINRHH
SEPLKEDRGVADKHQESKITKDQSEDSDTQNIVSGESCELPCWSHSDPESMSLFDEYFND
DSIETRTIDDVPVKTSTDSKEYCCMLEYPKRLYTKTNKQKSELCKCIETVHQDSCNACFP
QQDQRNSLSILVPHGDKESSDKKNAVGTEWDIPRNESSDSALGDSESEDTGPDIRRQAGG
YCGGDQEDWTEEDEIPFPGSKLIEVSAVQPNIANFGRSLLGGYCSSYVPDFVLQGIGNDE
RLRQCLVSDLSHAVQHPVLDEPIAEAVCIIADMDKWTVQVASSQRRVTDNKLGKEVLVSS
LVSNLLHSTLQLYKHNLSPNFCVMHLEDRLQELYFKSKMLSEYLRGQMRVHVKELGVVLG
IESSDLPLLAAVASTHSPYVAQILL
NT seq 3498 nt NT seq  +upstreamnt  +downstreamnt
atggcccccaccctgttccagaagctcttcagcaagcggagcggattaggcgcgccggga
cgagacgcccgcgacccggactgcgcgttcagttggcccttgccagaatttgacccaagt
cagattcgactgatcgtatatcaagactgtgaaagacgagggagaaatgtattgtttgac
tccagtgttaagagaaaaaatgaggacacatcagtatcgaagctctgtaatgatgctcaa
gtcaaggtctttgggaagtgctgccagctgaagccaggaggagatagttcttcctctttg
gatagctctatcactttatcttctgatggaaaagaccagtgtcccaaataccagggttct
cggtgttcttctgatgccaatatgcttggagagatgatgtttggctcagtagcaatgagc
tacaaaggatccaccttaaaaattcatcagatccgctcgcctccacagcttatgcttagc
aaagttttcaccgcacggactggcagtagtatctgtgggagtctcaatactctgcaggac
agtcttgaattcatcaatcaggacagtaatacattgaaagctgatagcagcacagttagt
aatgggctgcttggaaatataggtctttcacagttctgcagccccaggcgggctttctct
gagcagggtccgctccgcctgatcaggagtgcctctttctttgcagttcacagcaaccca
atggacatgccaggaagagaactgaatgaggacagagacagcggcatagcacgttctgca
tctctgagcagcttgttcatcaccccattcccctccccaaactcttcacttacccgaagc
tgtgctagcagctaccagcgacgttggcgacgtagccaaacaacaagtttggaaaatggg
gtgtttcctagatggtctgtagaagaaagctttaatctgtcagatgaaagttgtggccct
aatccaggaattgtgaggaaaaagaagattgcaattggggtaatcttttcattatccaaa
gatgaagatgaaaataacaaattcaatgaattctttttttcacattttcctctctttgaa
agccacatgaacaaattaaaaagtgcaatagaacaggcaatgaaaatgagccggagatca
gctgatgccagccagagaagtttggcatacaatcgaatacttgatgccctgactgagttc
agaacaacaatttgtaatctttatacaatgccaagaattggggaacctgtctggcttaca
atgatgtcagggactccagagaagaaccagctttgccatcgtttcatgaaggaattcacc
tttctaatggaaaatgcctccaaaaatcaattcttgccagctctcattactgcagttttg
accaatcatcttgcctgggttccaacagtcatgccaaatggacagccacctataaaaata
tttttagaaaaacattcctctcagagtgtgggcatgttggcaaagactcatccatataac
cctctttgggcacaacttggagatttgtatggcgctattggatctcctgtacggttagca
agaactgtagtcgttggcaaacgacaagacctggtccagagactgctttattttcttact
tacttcatcagatgctctgaacttcaagaaacccatcttttagaaaatggagaagatgaa
gccattgttatgccaggcacagtgattactaccactttagaaaagggggaaatagaggaa
tcagagtatgtgctaatcacaatgcatagaaacaaaagcagcttgctctttaaagagtca
gaagagacaagaactcccaactgtaactgtaaatattgcagtcatccagtccttgggcaa
aatacagagaatgtgtcacaaccagaaagagaagatactcaagacaactctaaggaattg
ctaggaatttcagatgaatgccaaaagatttctcctcctgactgccaagaagaaaatgct
gttgatgttcaacagtacagagataaattaagaacttgccttgacaccaagttagagaca
gttgtttgtacaggatctgctccagccgacaaatgtgtgttgtcagagacatgcttggaa
ccaagagaagaatcctggcagaataaggaattgctggattcagataatcacacaggcaca
gcaatgagacccacaggaatagttgttgaaaagaaacctccagataagaatgtgcccagt
gcattttcctgtgaggtaactcagacaaaggttacgttcttgattggagattctatgtca
cctgattcagatactgaacttcggagtcaggctgtggtggatcagattaacagacatcac
agcgaaccactaaaggaagacagaggagtggctgataagcatcaagaaagtaaaataact
aaggaccaatctgaagactctgacacacagaacatagtttctggagagtcctgtgagctt
ccttgttggagtcattcagatccagaaagcatgagcttgtttgatgaatattttaatgat
gattcaattgaaaccaggactattgatgatgttccagttaaaacaagtacagatagtaaa
gagtattgctgtatgttggagtatccaaaaagattgtatacaaaaactaacaaacagaaa
agtgaactttgtaaatgtatagaaacagttcatcaagattcatgtaatgcctgctttcct
cagcaggaccagaggaattccctctccattcttgtcccccatggggataaagagagttca
gacaaaaaaaatgctgtaggaactgaatgggacattccaagaaatgaaagttcagatagt
gcccttggagatagtgagagtgaagacacaggcccggacataaggagacaagctggcggt
tactgtggaggggaccaggaagactggacagaagaggatgagataccttttcctgggtca
aaattgattgaagtgagtgctgttcagcccaacattgccaactttggaagatctttgctg
ggtggctactgctcatcttatgttcctgactttgttcttcaaggaattggaaatgatgag
aggctccgtcagtgcctggtatcagatttgtctcatgctgtgcagcatccagtgttagat
gaaccaatagcagaagctgtctgtattatagctgatatggataaatggactgttcaagtg
gccagcagtcagagacgagtaacagataataaattgggaaaggaggtgttggtctctagt
cttgtttccaacctgcttcattccactcttcagctttataaacataatttatctccaaac
ttttgtgtaatgcaccttgaagaccggttacaggagttatacttcaagagcaaaatgctg
tctgagtacctgaggggacagatgcgtgttcatgtcaaggagctaggagtggttcttggg
attgaatccagtgaccttcctcttctggctgcggtagcaagcacccactctccatacgtt
gctcagatactcctttaa

DBGET integrated database retrieval system