KEGG   Mus musculus (mouse): 216766
Entry
216766            CDS       T01002                                 

Gene name
Gemin5, AA407055, AA407208, AI451603, BB194447, C330013N08
Definition
(RefSeq) gem nuclear organelle associated protein 5
  KO
K13133  gem associated protein 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  RNA transport
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    216766 (Gemin5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    216766 (Gemin5)
   03041 Spliceosome [BR:mmu03041]
    216766 (Gemin5)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     216766 (Gemin5)
   mRNA cycle factors
    P-body specific factors
     216766 (Gemin5)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   SMN complex factors
    216766 (Gemin5)
SSDB
Motif
Pfam: ANAPC4_WD40 WD40 Nup160 Lgl_C Clathrin
Other DBs
NCBI-GeneID: 216766
NCBI-ProteinID: NP_766146
MGI: 2449311
Ensembl: ENSMUSG00000037275
Vega: OTTMUSG00000005726
UniProt: Q8BX17 Q3TR97
Position
11; 11 B1.3
AA seq 1502 aa
MKPEPRTLPPSPNWYCSRCSDAAPGGIFGFAARTSVFLVRVGPGAGASPGAPPFRVVGEL
VGHTERVSGFTFSHHPGQYNLCATSSDDGTVKVWDVETKTVVTEHTLHQHTISALHWSPT
VKDLIVSGDEKGVVFCYWLNRNDSQHLFTEPRTIFCLTCSPHHENLVAIGYKDGIVVIID
ISKKGEVIHRLRGHDDEIHSIAWCPLSGEDCLSISQEENSEEPDIPNGKLIAETPITKGC
YLATGSKDQTIRIWSCSRGRGVMVLKLPFLKRRSGGVDPTVKERLWLTLHWPKNQPTQLV
SSCFGGELLLWDLTQSWRRKYTLFSTSAEGHNHSRIVFNLCSLKTEDGKQLLLSTSMDRD
VKCWDMATLECCWTLPSLGGFAYSLAFSPVDVGSLAIGVGDGMIRVWNTLSIKNNYDVKN
FWQGVKSKVTALCWHPNKEGCLAFGTDDGKVGLYDTCSNKPPQISSTYHKKTVYRLAWGP
PVPPMSLGGEGDRPSLTLYSCGGEGVVLQHNPWKLSGEAFDINKLVRDTNSIRYKLPVHT
EISWKGDGKVLALGNEDGSIEIFQVPNLRLLCTIQQHHKLVNAIVWHHEHGSRPELSCLL
ASGSNNAVIYVHNLKAVLESNPESPITITEPYRTLSGHTAKITSLAWSPHHDGRLVSACY
DGTAQVWDALREEPLFNFRGHRGRLLCVAWSPVDPECIYSGADDFCVYRWLTSMQDHSRP
PQGKKCIELEKKRLSQFKPKLKKKKKPTLRLPVKQDSSVGNEDESVKENSGPAENGLSDQ
DGEEEAQEPELPPSPVVCVEPVSCTDICSGFEKSKVTVSSKATSLKKEPAKEKPEALLKK
RKARSMLPLSTSLDHRSKEELHRDCLVLATATHAKAELNEDVSADLEERFHLGLFTDRAT
LYRMMETEGKGHLESGHPELFHQLMLWKGDLKGVLQAAAERGELTDSLVAVAPVAGYSVW
LWAVEAFAKQLCFQDQYVKAASYLLSIHKVYEAVELLKSNHLYREAIAVAKARLRPEDPV
LKELYLSWGSILERDGHYAIAAKCYLGATSAYDAAKVLARKGDAASLRTAAELAAIAGEH
ELAASLALRCAQELLLMKNWVGAQEALGLHESLQGQRLVFCLLELLCRHLEEKQPLEVRG
PSSIYHQWATGSEGTLVQRVTGVWRSAFSVDTPEQCQAALQKLQDVKYPSATSNTPFRQL
LLHVCHDLTLAMLSQQAAAWEEAVPALLQAVVRSYTSGNFTLMQEIYSAFLPGGCDHLRD
KLGDLSPAMAAYKSLEAFCIYGQLYEVWWSLCGPGPESSVWVLSAESTVSDKQSKPEDSA
SAEDMEQPPGPGPRLSAESERLLSACKELFSERHASLQTSQRTVAEVQETLAEMIRQHQK
SQLCKATTNGPSRDEPSRDEPSQEAERAPSQPPSPTEERNAPVSLPELTRRLTEANERIA
EFPESVKAWPFPDVLECCLVLLHIGSQCPDAVDPEMQQQAQELLHKYGHTRAYRRHCQSR
HT
NT seq 4509 nt   +upstreamnt  +downstreamnt
atgaagccggagccgcggacgctgccgccgtcccccaactggtactgctcacgctgcagc
gacgcggcgcccggaggcatctttggcttcgctgcgcggacctccgtcttcctcgtccgc
gtgggtccgggtgcgggcgcgagcccaggggcgcccccgtttcgagtggtaggagagttg
gtgggacacactgaaagagtatctggtttcactttttctcatcaccctggacaatacaac
ctctgtgccaccagctcagacgatggaactgtgaaggtttgggatgtagagaccaagact
gtagtgacagaacacacactccatcagcatacaatatcagcactgcattggtctccgaca
gttaaggacttaatagtctctggggatgaaaaaggagtcgttttctgttactggcttaac
agaaatgacagccagcacctcttcacagagcccaggaccatattctgtctgacgtgttca
cctcatcacgaaaatctagtagccattggctacaaagatggcatagtggttatcattgac
atcagtaaaaagggagaagttattcacagacttcgaggccacgatgacgagatccactcc
atagcctggtgtcctctgtctggtgaagactgcttatccatcagccaagaggaaaactcg
gaagaacctgacattcccaatgggaagcttatagcagaaacccccatcacaaaaggctgc
tacttagccacaggaagcaaagatcagaccattcgaatctggagctgttcccgcggccgg
ggtgtaatggttttgaaattgcccttcctgaagagaagaagtgggggtgtggacccaaca
gttaaagaacggctttggttgacacttcattggcctaagaaccaaccaacacagctggta
tccagttgttttggaggtgagctgctgctatgggacctcacccagtcatggaggcggaag
tacacgctcttcagcacctcagcagaagggcacaatcattccagaattgtcttcaatctg
tgttctctgaagactgaagatggcaagcagctgctactgtccacatccatggatagagat
gtaaaatgttgggacatggccaccctggagtgttgctggacattgccttctcttggaggt
tttgcctacagcctggccttttctcctgtggacgtgggctccctggccataggtgttggg
gacggcatgatccgggtgtggaatacactctccataaagaacaactacgacgtgaaaaac
ttctggcaaggagtcaagtccaaggtcacagcgctatgctggcacccaaacaaggaaggc
tgcttagccttcgggaccgatgacggaaaagtgggattgtatgacacctgctccaacaaa
cctccacagatttcaagcacgtatcataagaagaccgtgtataggttggcttgggggcca
ccagtcccccccatgtcacttggaggggaaggagacaggccttccctcaccttgtacagc
tgtggaggggaaggcgttgtgctacagcataacccctggaagctcagtggagaggccttc
gacatcaacaaactcgtgagggacaccaactccattagatacaaactgcccgtgcacaca
gagatcagctggaaaggagatggcaaagtcctggctcttgggaatgaagatggatcaata
gaaatattccaagtccccaacttgaggctgctgtgcaccatccagcagcaccacaagctt
gtgaacgccatagtctggcaccatgagcatggcagccgtccagagctgagctgtctcctt
gcttctggctccaacaatgcagtcatctacgtgcacaacctgaaagcagtcctagaaagc
aatcctgagtctccaataaccatcacagagccctaccgcaccctctcggggcacacagcc
aagattaccagtctggcatggagcccacatcatgacggaaggctggtatctgcttgctac
gatggcacagctcaggtgtgggatgccctccgggaagaacctttgttcaatttccgagga
catcgaggccggctgctatgtgtcgcgtggtccccagtggatccagaatgcatctactca
ggtgcagatgacttctgtgtctacaggtggctgacttccatgcaggaccattcccggcct
cctcaagggaaaaaatgtattgaactagagaaaaaacgactctctcaatttaagccaaag
cttaaaaagaagaaaaaacctaccttgcgactgcctgtaaagcaggattcatccgttggc
aatgaagatgagagtgtaaaggagaactctggacctgctgagaacggcttgtcggaccag
gatggtgaggaggaagcccaggagccagagctgcctccctctcctgtagtttgtgtagaa
cctgtttcctgtactgacatttgctcaggctttgaaaagtcaaaagtcactgttagtagc
aaagccacctcactgaaaaaggagccagctaaagagaaaccagaagccttgctcaagaag
aggaaggctcgctccatgctccctctgagcaccagcttagaccacaggtccaaagaggag
ctccatcgagactgcttggtactagcaactgcaacacacgccaaagcagagctaaatgaa
gatgtgtctgccgaccttgaggaacgattccacttgggccttttcacagacagggctact
ctatacaggatgatggaaacagaagggaaaggtcacttggaaagtggccaccccgagctt
tttcaccagctcatgctctggaaaggagatctgaagggtgttctccaggctgcagcagag
agaggcgagctgacagacagtctcgtggctgtggcaccagtggctggctacagtgtatgg
ctgtgggctgtggaagcctttgccaagcagctgtgtttccaggaccagtacgtcaaggct
gcctcttatctgctatccatccacaaagtgtacgaagctgtggaacttctcaagtcaaac
catctctacagagaagctattgcagttgccaaggctcggctgcgccctgaggaccctgtt
ctgaaggaactatacctcagctgggggtccatcctggagagagatggccactatgctatt
gcagccaagtgctacttaggagccacttccgcctatgatgcagccaaagttctggccaga
aagggagatgcagcctcacttagaacagctgcagagctggctgccatagcaggagaacat
gagctggctgcttccctggctcttagatgtgcccaagagctgcttctgatgaagaactgg
gtgggtgcacaagaagcattgggactgcatgaaagcctgcagggccagagactggtcttc
tgcctccttgaacttctatgccggcacctggaggaaaaacagcctctagaggtcagaggc
ccctcttccatttaccaccagtgggccacaggttctgagggaaccttggtgcagagagta
accggtgtgtggcgcagcgccttcagtgtggacaccccggagcagtgtcaggccgcctta
cagaagctgcaggatgtcaagtacccatcagcaacaagtaacactcccttcagacagctg
ctgcttcatgtctgccatgacctgaccttggcaatgctgagccagcaggctgctgcctgg
gaggaggcagtgcctgctctgctgcaggctgtggttcggagctatacctcagggaacttc
accctcatgcaggaaatctactcagcctttctcccaggtggctgtgaccacctacgagac
aaactgggtgacctctctcctgccatggcagcttacaaaagcttagaggccttttgtatt
tatgggcaactgtatgaagtctggtggtcgctctgcgggcctggccctgagtcaagcgtc
tgggtgttgtcagctgaaagcacggtctctgataaacagagcaagccagaggacagtgcc
agtgctgaggacatggaacagcctccaggcccgggcccgaggctcagtgcagagagtgag
cgtttgctgagtgcctgcaaggagcttttctcagaacggcatgccagcctgcagacctcc
cagaggactgtagccgaagtccaagagacactggcagaaatgatccgccagcaccaaaag
agtcagctctgcaaggccacaacaaatggtcccagcagagatgaacccagcagagatgaa
cccagccaggaagcagagcgggctccttctcagcctccgagcccaacagaagaaagaaat
gcaccagtgtctctccctgaactaaccagaaggctcacagaggcaaatgagaggatagca
gagtttccagagagtgtaaaggcctggccctttccagatgtgctggagtgctgtctcgtc
ttgcttcacattgggtcccagtgtcctgacgctgtggaccctgagatgcagcaacaggcc
caggagctccttcacaagtatgggcacactcgagcttacagaagacactgccagagtcgg
cacacgtga

DBGET integrated database retrieval system