KEGG   Mus musculus (mouse): 216799
Entry
216799            CDS       T01002                                 

Gene name
Nlrp3, AGTAVPRL, AII/AVP, Ci, Cias1, FCAS, FCU, MWS, Mmig, Mmig1, N, NALP3, Pyp, Pypaf1, cry
Definition
(RefSeq) NLR family, pyrin domain containing 3
  KO
K12800  NACHT, LRR and PYD domains-containing protein 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04217  Necroptosis
mmu04621  NOD-like receptor signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu05132  Salmonella infection
mmu05133  Pertussis
mmu05135  Yersinia infection
mmu05164  Influenza A
mmu05171  Coronavirus disease - COVID-19
mmu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    216799 (Nlrp3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    216799 (Nlrp3)
   04625 C-type lectin receptor signaling pathway
    216799 (Nlrp3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    216799 (Nlrp3)
   05164 Influenza A
    216799 (Nlrp3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    216799 (Nlrp3)
   05135 Yersinia infection
    216799 (Nlrp3)
   05133 Pertussis
    216799 (Nlrp3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    216799 (Nlrp3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    216799 (Nlrp3)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mmu04054]
    216799 (Nlrp3)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    216799 (Nlrp3)
Pattern recognition receptors [BR:mmu04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   216799 (Nlrp3)
SSDB
Motif
Pfam: NACHT NLRC4_HD2 PYRIN NOD2_WH LRR_6 FISNA LRR_4 NB-ARC DUF3747
Other DBs
NCBI-GeneID: 216799
NCBI-ProteinID: NP_665826
MGI: 2653833
Ensembl: ENSMUSG00000032691
Vega: OTTMUSG00000005801
UniProt: Q8R4B8
Position
11; 11 B1.3
AA seq 1033 aa
MTSVRCKLAQYLEDLEDVDLKKFKMHLEDYPPEKGCIPVPRGQMEKADHLDLATLMIDFN
GEEKAWAMAVWIFAAINRRDLWEKAKKDQPEWNDTCTSHSSMVCQEDSLEEEWMGLLGYL
SRISICKKKKDYCKMYRRHVRSRFYSIKDRNARLGESVDLNSRYTQLQLVKEHPSKQERE
HELLTIGRTKMRDSPMSSLKLELLFEPEDGHSEPVHTVVFQGAAGIGKTILARKIMLDWA
LGKLFKDKFDYLFFIHCREVSLRTPRSLADLIVSCWPDPNPPVCKILRKPSRILFLMDGF
DELQGAFDEHIGEVCTDWQKAVRGDILLSSLIRKKLLPKASLLITTRPVALEKLQHLLDH
PRHVEILGFSEAKRKEYFFKYFSNELQAREAFRLIQENEVLFTMCFIPLVCWIVCTGLKQ
QMETGKSLAQTSKTTTAVYVFFLSSLLQSRGGIEEHLFSDYLQGLCSLAADGIWNQKILF
EECDLRKHGLQKTDVSAFLRMNVFQKEVDCERFYSFSHMTFQEFFAAMYYLLEEEAEGET
VRKGPGGCSDLLNRDVKVLLENYGKFEKGYLIFVVRFLFGLVNQERTSYLEKKLSCKISQ
QVRLELLKWIEVKAKAKKLQWQPSQLELFYCLYEMQEEDFVQSAMDHFPKIEINLSTRMD
HVVSSFCIKNCHRVKTLSLGFFHNSPKEEEEERRGGRPLDQVQCVFPDTHVACSSRLVNC
CLTSSFCRGLFSSLSTNRSLTELDLSDNTLGDPGMRVLCEALQHPGCNIQRLWLGRCGLS
HQCCFDISSVLSSSQKLVELDLSDNALGDFGIRLLCVGLKHLLCNLQKLWLVSCCLTSAC
CQDLALVLSSNHSLTRLYIGENALGDSGVQVLCEKMKDPQCNLQKLGLVNSGLTSICCSA
LTSVLKTNQNFTHLYLRSNALGDTGLRLLCEGLLHPDCKLQMLELDNCSLTSHSCWNLST
ILTHNHSLRKLNLGNNDLGDLCVVTLCEVLKQQGCLLQSLQLGEMYLNRETKRALEALQE
EKPELTIVFEISW
NT seq 3102 nt   +upstreamnt  +downstreamnt
atgacgagtgtccgttgcaagctggctcagtatctagaggaccttgaagatgtggacctc
aagaaattcaaaatgcatttggaagattacccgcccgagaaaggctgtatcccagtcccc
aggggccagatggagaaggcagatcacttggatctagccacactcatgattgacttcaat
ggcgaggagaaggcctgggccatggctgtgtggatctttgctgcgatcaacaggcgagac
ctctgggaaaaagctaagaaggaccagccagagtggaatgacacgtgtacatcacattcc
tctatggtatgccaggaggacagccttgaagaagagtggatgggtttgctgggatatctc
tcccgcatctccatttgtaaaaagaagaaagattactgtaagatgtacagacgacatgtg
agaagcaggttctactctatcaaggacaggaacgcgcgtctaggtgagagtgtggacctc
aacagtcgctacacgcagctccaactggtcaaggagcatccaagcaagcaggagcgggag
catgaactcctgaccatcggccggactaaaatgcgggacagccccatgagttcccttaag
ctggagctgctgtttgagcccgaggacgggcactcggagcctgtgcacacagtggtgttc
cagggagcagcaggcatcgggaaaaccatcctagccaggaagattatgttggactgggca
ctgggaaagctcttcaaagacaaatttgactatttgttctttatccactgccgagaggtg
agcctcaggacgccaaggagtctagcagacctgattgtcagctgctggcctgacccaaac
ccaccagtgtgcaagatcctgcgcaagccttccaggatcctcttcctcatggatggcttt
gatgagctacaaggggcctttgacgagcacattggggaggtctgcacagactggcaaaag
gctgtgcggggagacattctgctaagcagcctcatccgaaagaaactgctgcccaaggcc
tctctgctcataacgacgaggccggtagccttggagaaactgcagcatctcctggaccac
ccccgccatgtggagatcctaggtttctctgaggccaaaaggaaggagtatttctttaag
tatttctccaacgagctgcaggcccgggaggccttcaggctgatccaagagaatgaggtc
ctctttaccatgtgcttcatccccctggtctgctggattgtgtgcacggggctaaagcaa
cagatggagaccgggaagagcctggcccagacctccaagaccactacggccgtctacgtc
ttcttcctttccagcctgctgcaatcccgggggggcattgaggagcatctcttctctgac
tacctacaggggctctgttcactggctgcggatggaatttggaaccagaaaatcctattt
gaggagtgtgatctgcggaagcacggcctgcagaagactgacgtctccgctttcctgagg
atgaacgtgttccagaaggaagtggactgcgagagattctacagcttcagccacatgact
ttccaggagttcttcgctgctatgtactatttgctggaagaggaggcagagggggagacc
gtgaggaaaggaccaggaggttgttcagatcttctgaaccgagacgtgaaggtcctacta
gaaaattacggcaagtttgaaaaaggctatctgatttttgttgtccgattcctctttggc
cttgtaaaccaggagagaacctcttatttggagaagaaactaagttgcaagatctctcag
caagtcagactggaactactgaagtggattgaagtgaaagccaaggccaagaagctgcag
tggcagcccagccaactggaactgttctactgcctgtacgagatgcaggaggaagacttt
gtgcagagtgccatggaccactttcccaaaattgagatcaacctctctaccagaatggac
cacgtggtttcctccttttgtattaagaactgtcatagggtcaaaacgctttccctgggt
ttttttcacaactcgcccaaggaggaagaagaagagaggagaggaggtcgacccttggac
caggttcagtgtgttttcccagacactcatgttgcctgttcttccagactggtgaactgc
tgcctcacttctagcttctgccgtggtctcttctcaagtctaagcaccaaccggagcctc
actgaactggacctcagtgacaatactctgggagacccgggcatgagggtgctgtgtgag
gcactccagcacccaggctgtaacattcagagactgtggttggggcgctgcggactgtcc
catcaatgctgcttcgacatctcctctgtcctgagcagcagccagaagctggtggagctg
gacctcagtgacaatgccctgggggactttggaatcagattgctgtgtgtgggactgaag
cacctgctctgcaacctccagaaactgtggttggtgagctgctgtctcacatccgcgtgt
tgtcaggatctcgcattggttctgagctccaaccattctctgaccagactgtacattgga
gaaaatgccttgggagactcaggagtccaagttttgtgtgaaaagatgaaggacccacag
tgtaacttgcagaagctggggttggtgaattccggccttacttcaatctgttgttcagct
ctgacctctgtgctcaaaaccaaccagaacttcacacacctctatctacgaagcaatgcc
cttggagacacaggactcaggctcctctgtgaggggcttctgcacccggactgtaaacta
cagatgctggaattagacaactgcagcctcacctcacacagctgctggaatctctccaca
attctgacccacaaccacagccttcggaagctgaacctgggcaacaatgatcttggcgat
ctgtgcgtggtgaccctctgtgaggtgctgaaacagcagggctgcctcctgcagagccta
cagttgggtgaaatgtacttaaatcgtgaaacaaaacgtgccttagaagcgctccaggaa
gaaaagcctgagctgactatagtcttcgagatttcctggtag

DBGET integrated database retrieval system