KEGG   Mus musculus (mouse): 216805
Entry
216805            CDS       T01002                                 

Gene name
Flcn, AU014660, B430214A04Rik, Bhd, FLCL
Definition
(RefSeq) folliculin
  KO
K09594  folliculin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04150  mTOR signaling pathway
mmu05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    216805 (Flcn)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    216805 (Flcn)
SSDB
Motif
Pfam: Folliculin_C Folliculin
Other DBs
NCBI-GeneID: 216805
NCBI-ProteinID: NP_001258285
MGI: 2442184
Ensembl: ENSMUSG00000032633
Vega: OTTMUSG00000008092
UniProt: Q8QZS3
Position
11; 11 B1.3
AA seq 579 aa
MNAIVALCHFCELHGPRTLFCTEVLHAPLPQGAGSGDSPDQVEQAEEEEGGIQMSSRVRA
HSPAEGASSESSSPGPKKSDMCEGCRSLAVGHPGYISHDKETSIKYVSHQHPNHPQLFSI
VRQACVRSLSCEVCPGREGPIFFGDEQHGFVFSHTFFIKDSLARGFQRWYSIIAIMMDRI
YLINSWPFLLGRIRGIISELQAKAFKVFEAEQFGCPQRAQRMNTAFTPFLHQRNGNAARS
LTSLTSDDNLWACLHTSFAWLLKACGSRLTEKLLEGAPTEDTLVQMEKLADLEEESESWD
NSEAEEEEKAPVTPEGAEGRELTSCPTESSFLSACGSWQPPKLTGFKSLRHMRQVLGAPS
FRMLAWHVLMGNQVIWKSRDVNLVHSAFEVLRTMLPVGCVRIIPYSSQYEEAYRCNFLGL
SPPVPIPAHVLASEFVVVVEVHTATRSNLHPAGCEDDQSLSKYEFVVTSGSPVAADRVGP
TILNKIEAALTNQNLSVDVVDQCLICLKEEWMNKVKVLFKFTKVDSRPKEDTQKLLSVLG
ASEEDNVKLLKFWMTGLSKTYKSHLMSTVRSPTATESRS
NT seq 1740 nt   +upstreamnt  +downstreamnt
atgaacgccatagtcgccctctgccacttctgcgagctccatggcccccgcacgctcttc
tgcacggaagttctacacgctcccctgccccagggggccggaagtggggacagtcctgac
caggttgagcaggctgaggaggaggagggtggcattcagatgagcagccgggtccgtgcc
cacagcccagccgagggtgccagcagtgagtccagcagcccggggcccaagaagtcggac
atgtgtgagggctgccggtcacttgccgtagggcacccaggctatatcagtcatgataaa
gagacctctattaagtacgtcagtcaccagcaccccaaccacccgcagctcttcagcatc
gtccgccaggcctgtgtccggagcctgagctgtgaggtatgccctggtcgtgaaggcccc
atcttctttggtgatgagcagcacggctttgtgttcagccacaccttcttcatcaaagac
agcctggccagaggcttccagcgctggtacagcatcatcgccatcatgatggatcggatc
tacctcatcaactcctggcccttcctgctggggaggatccgcggcatcatcagtgagctc
caggccaaggccttcaaggtgtttgaggcagagcagtttggatgtccacagcgtgcccag
aggatgaacactgccttcacgcccttcctgcaccagaggaacggcaacgctgcccgctct
ctgacctccttgaccagtgatgacaacttgtgggcgtgtctgcacacttcctttgcctgg
ctcctgaaggcatgcggtagcaggctgacagaaaagctcttagagggcgctcccacagag
gacaccctggtccagatggagaagcttgctgacttggaggaagaatcagaaagttgggac
aattctgaggctgaggaggaggagaaagctcctgttacaccagagggtgctgaagggcga
gagctgaccagttgcccaacagagtcatcctttctctcagcctgtgggagctggcagccc
ccaaagcttaccggcttcaagtctcttcgacacatgagacaggtcttgggtgctccatcc
ttccgtatgttggcttggcatgtcctcatggggaatcaggtgatctggaaaagcagagat
gtgaacctggtccattcagcgtttgaagtcctccggaccatgctgcctgtgggctgtgtc
cgcatcatcccttacagcagccagtatgaggaggcctatcgctgcaacttcctggggctc
agccctcccgtgcctatccctgcccatgttctggcctcagagttcgtagttgtcgtggag
gtccacacggccactcgctcaaacctccaccctgctgggtgcgaggatgaccagtccctc
agcaagtatgagtttgtggtgaccagtggtagccctgtggctgcagacagagttgggccc
actatcctgaataagattgaagcagctctgaccaaccagaacctgtctgtggatgtggtg
gaccaatgtctcatctgcctcaaggaggaatggatgaacaaagtgaaagtcctgtttaaa
ttcaccaaggtagacagtcgccccaaggaggacacacagaagctcctaagcgtcctaggc
gcatcagaggaggacaacgtcaaactgctgaagttctggatgacgggactgagcaaaacc
tacaagtcccatctcatgtccaccgtccgaagccccacagctacagagtcacggagctga

DBGET integrated database retrieval system