KEGG   Mus musculus (mouse): 21682Help
Entry
21682             CDS       T01002                                 

Gene name
Tec
Definition
(RefSeq) tec protein tyrosine kinase
  KO
K07364  tyrosine-protein kinase Tec [EC:2.7.10.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04380  Osteoclast differentiation
mmu04660  T cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    21682 (Tec)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    21682 (Tec)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    21682 (Tec)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     21682 (Tec)
Protein kinases [BR:mmu01001]
 Non-receptor tyrosine kinases
  TEC family
   21682 (Tec)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 PH SH3_1 BTK SH3_9 SH3_2 SH3_3 Kinase-like APH SH3_10 Haspin_kinase PH_3
Motif
Other DBs
NCBI-GeneID: 21682
NCBI-ProteinID: NP_001106931
MGI: 98662
Ensembl: ENSMUSG00000029217
Vega: OTTMUSG00000025011
UniProt: P24604 Q3U436 Q3TH41
Structure
PDB: 

Position
5 C3.2; 5 38.44 cM
AA seq 630 aa AA seqDB search
MNFNTILEEILIKRSQQKKKTSPLNYKERLFVLTKSVLSYYEGRAEKKYRKGVIDISKIK
CVEIVKNDDGVIPCQNKFPFQVVHDANTLYIFAPSPQSRDRWVKKLKEEIKNNNNIMIKY
HPKFWADGSYQCCRQTEKLAPGCEKYNLFESSIRKTLPPAPEIKKRRPPPPIPPEEENTE
EIVVAMYDFQATEAHDLRLERGQEYIILEKNDLHWWRARDKYGSEGYIPSNYVTGKKSNN
LDQYEWYCRNTNRSKAEQLLRTEDKEGGFMVRDSSQPGLYTVSLYTKFGGEGSSGFRHYH
IKETATSPKKYYLAEKHAFGSIPEIIEYHKHNAAGLVTRLRYPVSTKGKNAPTTAGFSYD
KWEINPSELTFMRELGSGLFGVVRLGKWRAQYKVAIKAIREGAMCEEDFIEEAKVMMKLT
HPKLVQLYGVCTQQKPIYIVTEFMERGCLLNFLRQRQGHFSRDMLLSMCQDVCEGMEYLE
RNSFIHRDLAARNCLVNEAGVVKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYSR
FSSKSDVWSFGVLMWEIFTEGRMPFEKNTNYEVVTMVTRGHRLHRPKLASKYLYEVMLRC
WQERPEGRPSFEDLLRTIDELVECEETFGR
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcaacactatcctagaagagattcttattaaaaggtcccagcagaaaaagaag
acatcacccttaaactacaaagagagactttttgtacttacaaaatccgtgttgagctac
tatgagggtcgagcggagaagaaatacagaaagggcgtcattgatatttccaaaatcaag
tgtgtggagatagtgaagaacgatgatggtgtcattccctgtcaaaataaatttccattc
caggttgttcatgatgctaatacactttatatttttgcacctagtccacaaagcagggac
cgatgggtgaagaagttaaaagaagaaataaagaacaacaataatatcatgattaaatac
catcctaaattctgggcagatgggagttaccagtgttgtagacaaacagaaaaactagca
cccggatgtgagaagtacaatctttttgagagtagtataagaaagaccctgcctcccgcg
ccagaaataaagaagagaaggcctcctccaccaattcccccagaggaagaaaatactgaa
gaaatcgttgtagcgatgtatgacttccaagcgacggaagcacatgacctcaggttagag
agaggccaagagtatatcatcctggaaaagaatgacctccattggtggagagcgagagat
aagtatgggagtgaaggatatatcccaagtaattacgtcacagggaagaaatccaacaac
ttagatcaatatgagtggtactgcagaaataccaacagaagcaaagcagaacagctcctc
agaacggaagataaagaaggtggttttatggtgagagactccagtcaaccaggcttgtac
actgtctccctttacacaaagtttgggggagaaggctcatcaggtttcaggcattatcac
ataaaggaaacagcaacatccccaaagaagtattacctggcagagaagcatgctttcggg
tccattcctgagatcattgaatatcacaagcacaatgcggcagggcttgtcaccaggctg
cggtacccggtcagtacaaaggggaagaacgctcccactactgccggcttcagctatgat
aagtgggagattaacccatcagagctgacctttatgagagagttggggagcggactgttt
ggagtggtgaggcttggcaagtggcgggcccagtacaaagtggccatcaaagctatccgg
gaaggcgccatgtgtgaagaggatttcatagaggaagctaaagtcatgatgaagctgaca
caccccaagctggtacagctctatggtgtatgcacccagcagaagcccatctacatcgtt
accgagttcatggaacggggctgccttctgaatttcctccggcagagacaaggccatttc
agcagagacatgctgctaagcatgtgtcaagatgtctgtgaagggatggagtacctggag
agaaacagcttcatccacagagacctggctgccagaaattgtctagtgaatgaagcagga
gttgtcaaagtatctgattttggaatggccaggtacgttctggatgatcagtacacaagt
tcttctggcgccaagttccctgtgaagtggtgtcccccagaagtgtttaattacagccgc
tttagcagcaagtcagacgtctggtcgtttggtgtgctaatgtgggaaatattcacagaa
ggcaggatgccctttgagaagaacaccaattacgaagtggtaaccatggtgactcgtggc
caccgcctccaccggccaaagctggcttccaaatatttgtatgaggtgatgctgagatgc
tggcaagagagaccagagggaaggccttcctttgaagacttgctgcgtacgatagatgaa
ctagttgaatgtgaagaaacttttggaagatga

DBGET integrated database retrieval system