KEGG   Mus musculus (mouse): 216821Help
Entry
216821            CDS       T01002                                 

Gene name
Tmem11, 5730466P16Rik, AA409091
Definition
(RefSeq) transmembrane protein 11
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_morph_reg
Motif
Other DBs
NCBI-GeneID: 216821
NCBI-ProteinID: NP_775655
MGI: 2144726
Ensembl: ENSMUSG00000043284
Vega: OTTMUSG00000007749
UniProt: Q8BK08
Position
11; 11 B2
AA seq 190 aa AA seqDB search
MAAWGRRRLGPGGGGSRERVSLSATDCYIVHEIYSGENAQDQFEYELEQALEAQYKYIVI
EPTRIGDETARWITVGNCLHKTAVLAGTACLFTPLALPLDYSHYISLPAGVLSLACCTLY
GISWQFDPCCKYQVEYDAYKLSRLPLHTLTSSTPVVLVRKDDLHRKRLHNTIALAALVYC
VKKVYELYAV
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgtggggaaggaggcgtctgggtccgggcggcggcggctcccgagagagggtc
agcctctcagctacagactgctacattgtgcacgaaatctacagtggggagaacgcccag
gaccagtttgagtatgagctggagcaggcgctggaagcccagtacaagtacattgtgata
gagcccacccgaattggagacgagacagcacgctggatcaccgtaggcaattgcctgcac
aagacggccgtgttggcaggtactgcctgcctcttcaccccattggcactgcccctggat
tactcccactacatctccctgcccgctggtgtgctgagcctggcctgctgtaccctctat
gggatctcctggcagtttgacccttgctgcaagtaccaggtggagtatgatgcctataaa
ctgtcccgcctgcctctgcacacgctcacctcctccacaccagtggtgctggttcggaag
gacgacctgcacagaaagagactgcacaacacaatagccctggctgccctggtgtactgt
gtaaagaaggtttatgagctctacgccgtatga

DBGET integrated database retrieval system