KEGG   Mus musculus (mouse): 21683Help
Entry
21683             CDS       T01002                                 

Gene name
Tecta, Tctna
Definition
(RefSeq) tectorin alpha
  KO
K18273  alpha-tectorin
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    21683 (Tecta)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   21683 (Tecta)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VWD C8 Zona_pellucida TIL NIDO TILa FXa_inhibition
Motif
Other DBs
NCBI-GeneID: 21683
NCBI-ProteinID: NP_033373
MGI: 109575
Ensembl: ENSMUSG00000037705
Vega: OTTMUSG00000034859
UniProt: O08523
Position
9 A5.1; 9 23.63 cM
AA seq 2155 aa AA seqDB search
MNYSSLLRIWVSFIFALVRHQAQPRELMYPFWQNDTRTPKVDDGSSSEIKLAIPVFFFGV
PYRTVYVNNNGVVSFNVLVSQFTPESFPLTDGRAFIAPFWADVHNGIRGEIYYRETMDPA
ILRRATKDIRKYFKDMTTFSATWVFIVTWEEVTFYGGSSTTPVNTFQAVLVSDGSYTFTL
FNYYEINWTTGTASGGDPLTGLGGVMAQAGFNGGNLTNFFSLPGSRTPEIVNIQETTNVN
VPGRWAFKVDGKEIDPANGCTSRGQFLRRGEVFWDDLNCTIKCRCLDFNNEIYCQEASCS
PYEVCEPKGRFFYCSPVETSTCVVFGEPHYHTFDGFLFHFQGSCAYLLARQCLQTSSLPF
FSVEAKNEHRGGSAVSWVKELSVEVNGYKILIPKGSYGKVKVNDLVTSLPVTLELGAVKI
YQSGMSTAVETDFGLLVTFDGQHYASISIPGSYINSTCGLCGNYNKNPLDDFLRPDGRPA
MSVLDLGESWRVYHADWKCGSGCVDNCTQCDAATEALYFGSDYCGFLNKTDGPLWECGTV
VDATAFVHSCVYDLCSVRDNGTLLCQAIQAYALVCQALGIPIGDWRIQTGCVSTVRCPSF
SHYSVCTSSCPDTCSDLTASQNCATPCTEGCECNEGFVLSTSQCVPLHKCGCDFDGHYYT
MGEFFWATANCTVQCLCEEGGDVYCFNKTCRSGEVCAVEDGYQGCFPKRETVCLLSQNQV
LHTFDGAAYAFPSELSYTLLKTCPERPEYLEIDINKKKPDAGPAWLRGVRILVADQEVKI
GGVGALEVKLNGQDVELPFFHPSGRLEIHRNKNSTTVESKGVVSVQYSDVGLLYIRLSTM
YFNCTGGLCGFFNANASDEFCLPNGKCTDNLAVFLESWTTFEEICNGECGDLLKACNNDS
ELLKFYRSRSRCGIINDPSNSSFLECHGVVNVTAYYRTCLFRLCQSGGNESELCDSVARY
ASACKNADVEVGPWRTYDFCPLECPENSHFEECMTCTETCETLALGPICVDSCSEGCQCD
EGYALQGSQCVPRSECGCNFEGHQLATNETFWVDQDCQIFCYCNGTDNSVHCETIPCRDD
EYCMEESGLYYCQPRTDASCIVSGYGHYLTFDGYPFDFQTSCPLILCTTGSRPISDSFPK
FIVTAKNEDRDPSLALWVKQVDVNVFGYSIVIHRAYKHTVLVNNERLYLPLKLGQGKINI
FSFGFHVVVETDFGLKVVYDWKTFLSITVPRSMQNGTYGLCGRYNGNPDDDLEMPMGLPA
LSINEFGQSWVKRDTFCQVGCGDRCPSCAKVEGFSKVQQLCSLIPNQNAGFAKCHSKVNP
TFFYKNCLFDSCIDGGAVQTACSWLQNYASTCQTQGIAVTGWRNYTSCSVTCPPNSHYES
CVSVCQPRCAAIRLKSDCNHYCVEGCQCDAGYVLNGKSCILPHNCGCYSDGKYYEPKQLF
WNGDCTRRCRCFRRNLIQCDPRQCKSDEECALRSGVRGCFSTKTSYCLAAGGGVFRTFDG
AFLRFPANCAFVLSTICQKLPDISFQLIINFDKWSSPNLTIISPVYFYINEEQILINDRN
TVKVNGTQVNVPFITGLATKIYSSEGFLVIDTSPDIQIYYNGFNVIKISISERLQNKVCG
LCGNFNGDMTDDYVTLRGKPVVSSVVLAQSWKTNGMQKRPLAPSCNELQFSQYAATCDNV
HIQAMQGDGYCLKLTDMKGFFQPCYGLLDPLPFYESCYLDGCYNHKKFQLCGSLAAYGEA
CRSFGILSTEWIEKENCSGVVEDPCVGADCPNRTCELDNGGELCGCIEPPPYGNNSHDII
DAEVTCKAAQMEVSISKCKLFQLGFEREGVRINDRQCSGIEGEDFISFQINNTKGNCGNI
VQSNGTHIMYKNTIWIESANNTGNIITRDRTINVEFSCAYELDIKISLDSVVKPMLSVIN
LTVPTQEGSFTTKMALYKNASYKHPYRQGEVVLTTRDVLYVGVFVVGADSTHLILTLNKC
YATPSRDSNDKLRYFIIEGGCQNIKDNTIGIEENGVSLTCRFHVTVFKFIGDYDEVHLHC
AVSLCDSEKYSCKINCPQNSRIATDYSKEHKEQIISVGPIRRKRLDWCEDNGGCEQICTS
RVDGPLCSCVTGSLQEDGRSCRASNSSVELQVWTLLLIMTQISLWHLIYKSGATS
NT seq 6468 nt NT seq  +upstreamnt  +downstreamnt
atgaattattcatcattacttagaatttgggtctctttcatcttcgctcttgttcggcac
caagctcagcccagggagctcatgtatccattttggcagaatgacacgagaacccctaaa
gtagatgacggaagctcctctgagattaagttggccatccccgtcttcttctttggtgtt
ccttaccgcaccgtctatgtcaataacaatggtgttgtttccttcaacgtgctagtgagc
cagtttacaccagagtcctttcccctgacggacgggagggccttcattgctccattctgg
gcagatgtgcacaatggaattcggggtgagatctattacagagaaaccatggaccccgcc
atcctgagaagagccaccaaggacatcaggaagtacttcaaagacatgaccaccttctct
gccacttgggttttcattgtgacctgggaggaagtcacgttttacggaggcagcagtacc
acgcctgtgaacaccttccaggctgtgctggtatccgacggctcctacacattcacgctc
tttaattactatgagatcaactggacgactgggacagccagcggtggcgaccctctaaca
ggccttggaggtgtgatggcacaggcaggatttaatggtggaaacctcacgaatttcttc
agtcttccgggatcaaggacccctgagattgtaaatattcaagagaccacaaatgtcaat
gttccaggacgctgggcatttaaagttgacgggaaggaaattgacccggccaatggctgc
acctctagaggacagttccttcgtcgaggggaggtgttttgggatgacctgaactgtacc
atcaagtgtcgctgtctggatttcaacaatgagatctactgtcaggaggcctcctgtagc
ccctacgaggtgtgcgaacccaagggtcggttcttctactgcagcccagtggagaccagt
acctgtgtggtattcggggagccacactaccacacctttgatggcttcctcttccacttc
caaggctcgtgtgcttacctgttggcccgacagtgtctacaaacctccagcctccccttc
ttcagtgtggaggccaagaacgagcaccgagggggctctgctgtctcgtgggtaaaggag
ctctctgtcgaggtcaatggctacaagattctcattcctaaaggaagctatgggaaagtc
aaggttaatgacctagtgacttctttgcccgtcaccttagagttgggggcggtgaaaatc
taccagagtggcatgtctactgccgtggaaacagattttgggctcttagtgacgtttgac
ggccagcactacgcctccatttccatcccaggctcttacataaactctacctgtggccta
tgcgggaactacaacaaaaatccactggatgacttcctccgccccgatggcaggcccgcc
atgtcggtgctggacctaggagagagctggcgtgtctaccatgctgactggaagtgtggc
tctggctgtgtagacaattgtactcagtgtgatgcagccactgaggccctctactttggt
tctgactactgcggcttcctcaacaagacggatggccccctgtgggagtgcggcactgtt
gtggatgccacggcttttgtacacagctgtgtgtacgacctgtgcagtgtgagggacaac
ggcacgctcctctgccaagccattcaggcctacgccttggtgtgccaagcccttggcatc
ccaatcggagactggagaatccaaactgggtgtgtgtctaccgtgcggtgcccaagcttc
agccattactctgtatgtaccagtagctgtccggacacctgctcggacctgacggcctct
cagaactgtgccactccatgcacggaaggttgcgagtgcaacgagggctttgtcctcagc
accagccagtgtgtccctttgcacaagtgcggctgtgacttcgatggccactactatacc
atgggcgagttcttctgggccaccgccaattgtacagtgcagtgcttatgcgaagaggga
ggggatgtctactgcttcaacaagacctgccggagtggggaggtgtgtgctgtggaggac
ggttaccagggctgcttccccaagcgggagacggtgtgcctgctcagccagaaccaggta
ctacacacatttgatggcgccgcctacgcattcccatccgagttatcatataccctactc
aagacctgccctgagcgtcctgagtacttggaaattgacatcaacaagaagaagcctgat
gcagggccagcttggctccggggtgttcggatcctcgtggctgaccaagaggtcaagata
ggaggcgtcggggctttggaagtcaagctaaatggtcaagatgtggaattaccctttttc
catccttcggggaggttggagattcacagaaacaagaacagcacaactgtggagtccaag
ggtgtggtgtccgtccagtactccgatgtgggactactgtacatccgactgtccaccatg
tacttcaactgtactggaggcctgtgtggcttcttcaatgccaatgccagtgatgagttc
tgccttcctaatggcaaatgcacagacaacctggcggtgttcttggagagctggacaaca
tttgaggaaatctgcaatggcgagtgtggggacctgctgaaggcctgcaacaatgactcc
gagctgctcaagttctaccggagccgctcccggtgtggtatcatcaacgacccctccaac
agctccttcctggagtgccatggggtggttaatgtcaccgcctactaccgcacctgcctg
tttcgcctgtgccagagcggaggcaatgagtcagagctgtgtgattctgtggcccgctat
gccagtgcttgcaagaatgcagatgtggaggtgggcccctggaggacctatgacttctgc
cctctagaatgcccggagaacagccattttgaggagtgtatgacatgtacagagacctgc
gagaccctggccttgggccccatctgtgtggacagctgctctgagggatgccagtgtgat
gaaggttatgccctgcagggcagccagtgtgtccctcggagcgagtgcggctgcaacttt
gaggggcatcaacttgccaccaatgagaccttctgggtagaccaggactgccagatcttc
tgctactgcaatggcacagacaacagtgtccactgtgagaccattccctgcagggacgat
gaatactgtatggaagagagtggcttgtactactgccagccccgtactgatgcttcctgt
atcgtctcaggctatggtcactacctcacctttgatggctacccatttgacttccagacc
agttgtcctcttatcctctgcaccacaggaagcagaccaatctcagactctttccccaag
ttcattgtaacagccaagaatgaggaccgggacccatctctagccttgtgggtgaagcag
gtggacgtgaacgtgtttggctacagcattgtgatacaccgggcttacaagcacactgtg
ttggtcaacaatgagcggttgtacctgcccctgaagttaggacaagggaagataaacatc
ttttcattcggctttcatgtggttgtggagactgactttggcctgaaggtcgtgtatgac
tggaagaccttcctgtccattaccgtcccccggagcatgcagaacggcacctatggcctc
tgtggacgctacaatggcaaccccgatgatgaccttgagatgcccatggggctgcctgca
ctgagtatcaacgagtttggccagagctgggtgaagagagacaccttctgccaggtgggc
tgtggggaccgctgcccatcctgtgccaaagtggaaggtttctccaaagtacagcagctg
tgcagcctgatccccaaccagaatgctggctttgccaaatgtcacagcaaagtcaacccc
accttcttctacaaaaactgcctgtttgactcctgtatcgatgggggtgccgtgcagaca
gcctgcagctggttacaaaactatgccagcacttgccagactcaaggaatcgcagtgacc
ggctggaggaactacacgtcctgttcggttacctgcccccccaacagccactatgagagc
tgtgtgagcgtctgccagccccgctgcgcagccatccgcctgaagagtgactgtaatcac
tactgcgtagagggctgccagtgtgatgcaggctacgtcctcaatggcaagagctgcatc
ttgccccacaactgtggctgctactcagatggcaaatactatgagcccaagcagctattc
tggaatggggactgcacgcggcgctgccgctgtttcaggcgcaacctgatccagtgtgac
ccacgccaatgcaagtcagatgaggagtgcgccctgcgcagtggggtgcgcggctgcttc
agcaccaaaacctcctactgcctagcggcagggggtggtgtcttccgcacgttcgatggt
gccttcctgcgcttccctgccaactgcgccttcgtgctctcaaccatctgccagaaattg
ccagacatctccttccagctcatcatcaacttcgacaagtggtcctcgcccaacctcact
atcatctcaccggtctatttctacattaacgaagagcagattctcatcaacgatcggaac
actgtcaaggtgaatggcacacaagtaaatgttccatttataacgggcttggcaaccaaa
atctacagcagcgaggggtttctggtgatcgacaccagtcccgacatccagatatattac
aatggttttaacgtcattaaaatcagcatcagtgagaggctacagaacaaagtgtgtggg
ctctgtgggaacttcaatggagacatgactgacgactacgtgaccttgcgggggaaaccc
gtggtgagcagcgtggtgctggcccagagctggaagaccaatggcatgcagaagagacct
ctcgcccccagctgcaacgagctacagttctcacagtatgcagccacatgtgacaatgtg
cacatccaggccatgcagggtgacggctactgcctgaaactcaccgacatgaagggcttc
ttccagccctgctatgggctccttgatcccctcccgttctacgagtcctgttacctggat
ggctgctacaaccacaagaagttccagctgtgtggctccctggctgcctacggggaggcc
tgccgctccttcggcatccttagcaccgagtggattgagaaagagaattgctcaggagtg
gttgaagacccttgtgtgggggcggattgtcccaacaggacctgcgagctggacaacgga
ggagaattatgtggctgcattgagccacccccctatggaaacaattcccatgacatcatc
gacgcggaggtgacctgcaaggcagcccagatggaagtgtccatatctaagtgcaagctc
ttccagctgggctttgagagagagggtgtgagaatcaatgaccggcagtgctctggcatc
gagggcgaggattttatctcctttcaaatcaacaacaccaaagggaactgtgggaacatc
gtgcagtccaatggcactcatatcatgtataaaaacacaatctggattgaaagtgccaac
aacactggcaacatcatcacgagggaccgcacgatcaatgtggaattttcatgcgcttat
gagctagatatcaagatctccttagactctgtcgtgaagcctatgctaagtgtcatcaac
ctgacagttccgacccaggagggcagcttcaccaccaagatggcactctataaaaatgct
tcctacaaacacccttaccgccaaggggaagttgtgctgacaactcgggatgtgctgtac
gtgggcgtctttgtggtcggagctgactctacacacttgattctcacactcaacaaatgc
tacgccaccccctcccgagacagcaacgacaagcttcggtacttcatcatcgaaggagga
tgtcagaacatcaaagacaacaccattggcatagaggagaacggagtgtccctaacctgt
cgtttccacgtcaccgtcttcaagttcatcggagactacgatgaagttcatcttcactgt
gcagtgtccctctgtgactcagagaaatactcttgcaagattaattgcccacaaaattcc
aggatcgccacagattattcaaaagagcacaaagaacagatcatttcagtgggacccatt
aggagaaaaaggctggactggtgtgaagacaacggcggctgtgagcagatctgcaccagc
cgggtcgacgggcctctgtgcagctgtgtgaccggatccctgcaagaagatggaaggagc
tgcagagcctctaattcttcagtggaacttcaagtttggacacttcttctcatcatgacc
cagatctcactgtggcatttgatctataaatcaggcgcaacctcataa

DBGET integrated database retrieval system