KEGG   Mus musculus (house mouse): 216846
Entry
216846            CDS       T01002                                 
Symbol
Cntrob, 9830165K03Rik, Lip8, Nip2
Name
(RefSeq) centrobin, centrosomal BRCA2 interacting protein
  KO
K16468  centrobin
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    216846 (Cntrob)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation proteins
   Centriole proteins
    216846 (Cntrob)
   Centrosome duplication proteins
    Centriole replication proteins
     216846 (Cntrob)
SSDB
Other DBs
NCBI-GeneID: 216846
NCBI-ProteinID: NP_766148
MGI: 2443290
Ensembl: ENSMUSG00000032782
UniProt: Q8CB62
Position
11:complement(69188735..69214720)
AA seq 887 aa
MATAAPSPSSPLRPEDLLSDSSEPPGLNQVSSEVTSQLYTSLHLSRQAEATARAQLYLAP
TSSPPNEGLDSLAQELSRSLSVGLENNLKKKDGSKHIFEMESVRGQLQTMLHTSRDTAYR
TGSERREEDSFDSDSTATLLNTRPLQDLSPSSSAPALEELFPRYTSLRPGPPTNPPDFQG
LRDALDAELTRRKHCERHIQSLQTRVLELQQQLAVAVAADHKKDLMIEQLDKTLARVVEG
WNRHEAERTEVLRGLQEERQAAELTRSKQQETVTRLEQSLSEAMEALSREQEGARLQQRE
KEALEEERQALTLRLEVEQQQCRTLQEERDEARAGQLSEHRKLEALQVALQEERQAWIKQ
EHQLKERLQALQEEGQAQLEREKGNSQREAQAAWETQQQFALLQTEVRRLEGDLDTVRRE
RDALQLEMSLVQARYESQRIQMESELAVQLEQRVTERLAEAQENSLRQAASLRDHHRKQL
QELSGQHQQELAAQLAQFKVEMADREERQQQVAQDYELRLAREQARVRDLKSGNQQLEEQ
RAELVERLQAMLQAHWEEANQLLSTTLLPPNPQAPLAEPSSPGPLEPEKGERRTWAMPPM
AVALKPVLQQSREVKGDVPGAPSVLCSTSPDLSLLLGPPFQNQNSFQPLEPKPDVTPPTA
GPFSALEAFTDDHRAERPFPEEDPGSDGDARLPPASQLEGLKNFLQQLLETAPQSNGNPS
ADLLLPKAGSRAVSSWEEAPQVPRLPPPVHKTKVPLAMASSLFRVHGLPSTNLQGSGLST
GSPEKDGLNLVDVSELLRLYQARGWGALPAEDLLLYLKRLEHSGTDGQGELVPRRNTDSR
LGETTRKEIPSQAVPRRLASVPKTEKPARKKSGHPGPSMRSRGGIWR
NT seq 2664 nt   +upstreamnt  +downstreamnt
atggcgacagcagcccccagtcccagttctcctctccgacctgaggacctcctgagcgat
tcgtcagagcctcctgggttgaaccaggtgtcctccgaggtgacctcccaactgtatact
tctttgcatctcagccgccaagctgaggccacggcccgggcccagctgtatctagctccc
acctcctcacctcctaacgagggcttagacagcttggctcaagaactgagtcgcagcttg
tccgttggattggaaaacaacttgaagaaaaaggatgggtctaagcacatctttgagatg
gaaagtgttcggggtcagctccagaccatgctccatacctcccgtgatactgcctatcga
actggttcagagagacgggaagaggactcctttgacagtgatagcacagctaccttgctc
aacacccggcctctgcaagacctgtctccatccagctctgccccggcactggaagagttg
tttccccgctacactagccttcggcccggcccccccaccaaccccccagattttcagggg
ctgagggatgcactggatgcagagcttacacgcagaaagcattgcgagcgccacatccag
agcctacagactcgcgtgcttgagttgcaacaacagctagctgtggctgtggctgccgac
cacaagaaagatctcatgattgaacaactagacaagactctggctcgagtggtggaaggc
tggaatcgccatgaggctgagcggacagaggtgctgcggggacttcaagaggagcgccag
gcagcagaactcaccagaagcaagcagcaggagacagtgacccgcctggaacaaagcctt
tctgaggccatggaagccctgagtcgggagcaggagggtgccagactacagcagagggag
aaagaggccctggaagaagaaaggcaagccctgactctgaggttggaggtggagcagcag
cagtgccggaccctccaggaagagcgggatgaggctagggctgggcagctcagtgagcac
cggaagctggaggcccttcaagtggctctacaagaggaaaggcaggcctggatcaagcag
gaacaccagctgaaggaacgccttcaggcactgcaggaggaaggccaggctcagctggaa
agagagaaggggaacagccagagggaggcccaggcagcctgggagacccagcagcagttt
gcactgctccagactgaggtgcggcggctggaaggggatctggacacagtccggagagag
agagatgcactgcagctggagatgagcttggtccaggccagatatgagagccagcggatc
cagatggagtcagagctggctgtacagctggagcagcgggtgactgagcggctggcagag
gctcaggagaacagcctgcggcaggccgcctccctcagggaccatcacaggaagcagcta
caggaactgagtggacagcaccaacaggaactggctgcccagctggctcagttcaaggta
gaaatggctgaccgggaggaacgccagcagcaggtggctcaggactatgagctcagactg
gcaagggagcaagctcgagtgcgtgacctgaagagcggcaaccaacaactggaggagcag
cgggcggagctggtggagcggctccaagccatgctgcaggcccactgggaggaggccaac
caactgctcagtaccacgcttctgcctcccaatccgcaggctcctcttgctgagccctcc
agccccgggcctctggagccagagaagggggagaggaggacctgggccatgcctcccatg
gctgtggctctgaaacctgtgttgcagcagagccgagaagtgaagggtgatgtgcctgga
gctccgtctgtcctctgcagcacctccccagatctgagcctcctgctgggaccccctttc
cagaaccagaactcctttcagcccttggaacccaagcctgatgtgactccacccacagct
gggcccttctctgcattggaggctttcactgatgatcacagggccgaacgcccgtttcct
gaggaagacccgggatctgatggcgatgcaaggctgccacctgcttctcagcttgaaggc
ctcaagaactttttgcaacagctactggagacagcgcctcagagcaatggaaacccctca
gccgacctgttgctccctaaggctggctctcgggctgtctcgtcttgggaggaggcccct
caagtgccccgacttccacctcctgtccacaaaaccaaagttcccttagccatggcgtca
agtctcttcagggtccatgggcttccctcaaccaatttgcaaggcagtggtctcagcact
ggctccccagagaaagatgggctcaacctggtggacgtgtctgagctgttacgcctctac
caggctcggggttggggtgccctgcctgctgaggacctgctcctgtacctgaagaggctg
gaacacagtggaactgatggccaaggggagcttgtccccagaagaaacacagactcccgt
ttgggtgagaccactcggaaagagatcccctcccaggctgtccctcgacgccttgcttca
gtccctaagactgaaaagcctgcacggaagaaaagtgggcatcccggccctagcatgagg
agtcggggcggcatctggagatga

DBGET integrated database retrieval system