KEGG   Mus musculus (house mouse): 216860
Entry
216860            CDS       T01002                                 
Symbol
Neurl4
Name
(RefSeq) neuralized E3 ubiquitin protein ligase 4
  KO
K16777  neuralized-like protein 4
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    216860 (Neurl4)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    216860 (Neurl4)
SSDB
Motif
Pfam: Neuralized
Other DBs
NCBI-GeneID: 216860
NCBI-ProteinID: NP_001013432
MGI: 1921092
Ensembl: ENSMUSG00000047284
UniProt: Q5NCX5
Position
11:69792545..69804650
AA seq 1563 aa
MAAGSGGSGGSGAGPGPGPGPGGGGGPGSSGPGLGSGGGLGGGGELHPRTGRLVSLSACG
RTARRQQPGQEFNHGLVLSREPLRDGRVFTVRIDRKVNSWSGSIEIGVTALDPSVLDFPS
SATGLKGGSWVVSGCSVLRDGRSVLEEYGQDLDQLVEGDRVGVERTATGELRLWVNGRDC
GVAATGLPARVWAVVDLYGKCTQITVLPSEPGFSPPTPVPTPPLEPLAPPEDSALLEQGT
SVDEAFMVSPAQARPETFPNSLDSHNDFASMELSEVVSNAILSAYNGGLLNVSLSSPPAG
DGLASSGPATSPILTSNDALLFHEKCGTLIKLSNNNKTAERRRPLDEFNNGVVMTNRPLR
DNEMFEIRIDKLVDKWSGSIEIGVTTHNPNSLEYPATMTNLQSGTIMMSGCGILTNGKGT
RREYCEFSLDELQEGDHIGLTRKSNSALHFFINGIDQGVATPLTPPVVYGVVDLYGMAVK
VTIVHNNNHSDRLRRNNAILRALSPEGALRRAAPAAQAEPERLLFHPNCGQKAAITHEGR
TALRPHATDDFNHGVVLSSRALRDGEVFQVRIDKMVDKWAGSIEIGVTTHNPAYLQLPST
MTNLRSGTWMMTGNGVMHNGTTILDEYGHNLDRLKAGDTVGVVRREDGTLHFFVNGMTQG
PAAWNVPPGVYAVVDLYGQAAQATIVDDVEVPPVSEPLPEGNNQMSPSSPSSAAGGSDLR
FHQLHGSNAVITNGGRTALRHNCRSEFNDAIVISNRALRDGELFEIVIQKMVDRWSGSIE
AGVTAIRPEDLEFPNTMTDIDYDTWMLSGTAIMQDGNTMRNNYGCDLDALGTGARIGMMR
TAKGDLHYFINGQDQGAACSGLPPGKEVYAVVDLYGQCVQVSITNATGPMDNSLATSNTA
TEKSFPLHSPVAGVAHRFHSMCGKNVTLEEDGTRAVRVAGYAHGLVFSTKELKAEEVFEV
KVEELDEKWAGSLRLGLTTLAPEDMGPGAGSGPGLPPSLPELRTKTTWMVSSCEVRRDGH
LQRMNYGRNLERLGVGSRVGIRRCADDTMHILVDGEDMGPAAAGIAKNVWAVLDLYGPVR
SVAIVSSTRLEEPEGTQPPSPSSDTGSEVEEDDEVEEQGLRGQNQVGIVPTALEFLENHG
KNILLSNGNRTATRVASYNQGIVVISQPLVPHMLVQVRIDFLNRQWTSSLVLGVITCPPE
RLNFPASACALKRAAWLLRGRGVFHNGLKICEKFGPNLDTCPEGTILGLRLDSSGGLHLH
INGVDQGVAVPDVPQPCHALVDLYGQCEQVTIVSPDPGTASGKIAGTQGDMEKADMVDGI
KESVCWGPPPAASPLKSCEYHALCSRFQELLLLPEDYFMPPPKRSLCYCESCRKLRGDEA
HRRRGEPPREYALPFGWCRFNLRVNPHLEAGTLTKKWHMAYHGSSVAVVRRVLDRGELGA
GTTSILSCRPLKGEPGVGFEEPGENCAPPREEQPPPVLLSPSLQYAGAEMLASKVQFRDP
KSQRTHQAQVAFQVCVRPGSYTPGPPSAALRELPDQHFSPSELEWVTKEKGATLLYALLV
RVE
NT seq 4692 nt   +upstreamnt  +downstreamnt
atggcggcggggtcgggtgggagtgggggctctggggcgggccccgggccaggaccgggg
cccggcgggggtgggggccctggcagcagcggaccaggcctggggtccggcgggggtctc
ggcggtggcggggagctgcacccgcgcaccgggcgcttggtcagcctgtcggcctgcggg
cgcacggcgcggcggcagcagccgggccaagagtttaaccacgggctggtgctgagccga
gaacccttgcgcgatggacgcgtcttcaccgtccgcatcgaccgcaaggtcaactcctgg
agtggctccattgagattggagtgacagcactggatcccagtgtgttggacttcccgagc
agtgccaccgggctgaagggaggctcctgggtagtgtcaggctgctcagtgctgcgggac
gggcgctctgtgttggaggaatatggccaggacctggaccagcttgtcgaaggggaccgt
gtgggtgtggaacgcacagccactggggagctccggctctgggtaaacgggcgggattgt
ggtgtggcagccacaggcctgcctgctcgtgtctgggctgttgtggacctttatggcaag
tgcacccagatcactgtgctgccctccgagccaggcttcagccctcccactcctgtcccc
acacctccccttgagcccttggcccctccagaagattcagccctgttggaacaggggacc
tctgtggatgaagccttcatggtgtccccagcgcaggcacggccggagacgtttcctaac
agccttgattcgcataatgactttgccagtatggagctgtctgaggtggtgagcaacgcc
atcctgtctgcctacaatgggggcctccttaatgtgagcctgagctccccaccagcaggg
gacggactggcatccagtgggccagccacttctcccatcctcacttccaacgatgccctg
ctcttccatgagaagtgtgggaccctcatcaaactcagcaacaacaataagacagcagag
cgccggaggcccctggatgaattcaacaatggagttgtcatgaccaaccgcccacttcgg
gataatgaaatgtttgagatccggatcgacaagcttgtagacaagtggtctggttccatc
gagattggtgtcaccacccacaaccccaatagcctggagtacccagccaccatgaccaac
ctgcagtcaggcaccatcatgatgagtggctgtgggatcctgaccaacggcaaaggcact
cggcgggagtactgcgagttcagtctggacgagctgcaggagggtgaccatattggcctc
acgaggaagtccaactctgccctacacttcttcattaatggcatcgatcagggcgtagct
actccattgacaccaccagttgtatatggtgtagtagacttgtatggaatggcagtgaaa
gtgaccatcgtccataataacaaccacagtgaccgtctccgccggaacaacgctatcctg
agggctctgtcccccgagggtgctcttcgtcgtgctgcccctgcagcccaggcagaacct
gaacgcttgctcttccatcctaactgtggccagaaggcagctatcacccacgaaggacgc
actgccctgaggccccatgccactgatgacttcaatcatggcgtggtactgagcagcaga
gccctccgggatggagaggtgttccaggtgcgcattgacaagatggtggacaaatgggct
ggctccattgagattggtgtcaccacccataaccctgcctacctccagctaccctctact
atgaccaacttacgctctgggacctggatgatgactgggaatggggtcatgcacaatggg
acaaccatcctagatgaatatgggcacaacctggaccgcctcaaggcaggggacaccgtg
ggtgtggtgcggcgggaggatggaacgctccacttcttcgtcaatgggatgactcagggc
cctgctgcctggaatgtccccccgggggtctatgctgttgttgatctctacggccaggct
gcccaggctactattgtggatgacgtggaggtgcctccagtctctgagccactccctgaa
ggaaacaaccagatgtctcccagttctccatcctcagcagctgggggctctgaccttcgc
ttccaccagctgcacggcagtaatgcagtcatcaccaatggtggccgcactgctctccgc
cacaactgccgcagcgagttcaacgatgccattgtcatttccaaccgagccctgcgggat
ggagaactgtttgaaattgtcattcagaagatggtagatcgttggtcaggctccatcgaa
gctggagttactgctattcggccggaagacctagaatttcccaacaccatgacagacatt
gactatgatacgtggatgctgagtggtacagctatcatgcaagatggcaatacgatgcgc
aacaactatgggtgtgatctggacgcgctgggcacaggtgcacgaattggcatgatgcga
actgccaagggtgatctgcactatttcattaatggacaggaccaaggcgctgcctgctca
ggcttgcctccgggtaaagaggtgtatgcagttgtggatctctatggccagtgtgtccaa
gtgtctatcaccaatgctaccggccccatggacaacagcctggccaccagcaatactgcc
actgagaagtcattccccttgcattccccagtggcgggtgtggctcaccgattccatagc
atgtgtggcaagaatgtcactctggaggaggatggcacacgggcagtccgtgtggctggc
tacgcacatggcctcgttttcagcaccaaagagctcaaggctgaagaagtttttgaggtg
aaagtggaagagctagacgagaagtgggcaggctccctccggctggggctgaccacactt
gcaccagaggacatggggcctggagcgggcagtggtccagggctgcctccttccttgcct
gaactccggacaaagaccacctggatggtgtccagctgtgaagtgaggcgtgatgggcac
ctccaaaggatgaactatggccggaacctcgagagactaggggtgggaagccgtgtgggc
attcgtcggtgtgcagatgacacaatgcacatcttggtagatggagaagatatggggcct
gctgccgctggcattgccaagaatgtgtgggctgtgttggatctgtatgggccagtacgc
agtgtggccattgtcagctccacaaggctggaggaaccagaaggcacccagccgccttct
cccagctcagacactggcagtgaggtcgaggaagatgatgaggtcgaggagcaggggctg
agaggccagaatcaagtggggattgtgcccacagcccttgaattcctggagaaccatggg
aagaatatcctcttatccaacgggaaccgcacagccactcgggtggccagctataaccag
ggcatcgttgtcatcagtcagcccctggtgccccatatgcttgttcaggtgcgaatagac
ttcctgaaccgacagtggacatcttctcttgttctgggagttatcacctgcccacctgag
aggcttaacttccctgcctctgcttgtgcccttaaacgggcagcctggctcctgcggggc
cggggtgtcttccacaatggtctgaagatctgtgagaagtttgggccaaatcttgacacc
tgccctgaaggcaccatcctgggactgcggctagactcctctggagggcttcatctccac
atcaatggggtggaccaaggggtagctgtaccagatgtgccccagccatgccatgcactg
gtggacctctatggacagtgtgagcaggtgacaattgtgagccctgacccagggactgcc
agtgggaagattgctggaactcaaggggacatggaaaaagctgatatggtagacggtatc
aaggagagtgtgtgctggggtccaccgcctgctgctagccctttaaagagctgcgagtac
catgccctttgctcccgcttccaagaactgctgttgcttcctgaagattatttcatgcct
ccaccgaagcgtagcttatgctactgtgaatcttgccggaagttgcgaggagatgaggcc
cacaggcgccgaggagagcctccccgggagtacgccctgcctttcggatggtgcaggttc
aaccttagggtgaatccccatctggaagctggcacactaacaaagaagtggcacatggca
tatcatggaagcagtgtagctgttgtgcggagagtgctggaccgaggggagttgggagca
ggtactacctccatcctgagctgccgacctttgaagggagagcctggggtgggatttgag
gagcctggtgagaactgtgcacctccccgggaagagcagccccctccagtgctgctctcc
ccctcccttcagtatgccggggcagagatgctggcctccaaagtgcaattccgggaccca
aaatcccagcggacacaccaggctcaggtggcctttcaggtgtgtgtgcgccctggctcc
tatactcctggccctccctctgcggccctcagagaacttcctgaccagcacttcagccca
tcggaacttgagtgggtcactaaggagaagggagccacactcctctatgccctgctggta
cgagtggaataa

DBGET integrated database retrieval system