KEGG   Mus musculus (house mouse): 216881
Entry
216881            CDS       T01002                                 
Symbol
Wscd1, mKIAA0523
Name
(RefSeq) WSC domain containing 1
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: WSC Sulfotransfer_1
Other DBs
NCBI-GeneID: 216881
NCBI-ProteinID: NP_808286
MGI: 2448493
Ensembl: ENSMUSG00000020811
UniProt: Q80XH4
Position
11:71640719..71680475
AA seq 572 aa
MAKPFFRLQKFLRRTQFLLLFLTAAYLMTGSLLLLQRARVALPQALRAPGSLQALPVATV
ALGVGLLDGRSLRDPHSSPDLLLDVDTLRSPLARLPPGIRWPRRNRSSLRRRWLHHLTSD
PQGPPTLSPEASGPANHNRGNYLGCFSEEGQERTLKGAVFYDLRKMTVSHCQDACAERSY
VYAGLEAGAECYCGNRLPATRVSLKECNQECKGEKGSMCGAVRRLSVYSVGLQQPGSKKR
RTATYRGCFPLPENVTHTFSSSMTQANMTVETCSGFCSQKEFPLAILRGWDCYCAYPTPQ
FSLRDAVDGALCSQAPETQGLPGYCEVYQTPVQDTRCTDRKFLPDKSKVFVALSSFPGAG
NTWARHLIEHATGFYTGSYYFDGTLYNKGFKGEKDHWRSRRTICVKTHESGRREIEMFDS
AILLIRNPYRSLVAEFNRKCAGHLGYAPDRNWKSKEWPEFVNSYASWWSSHVLDWLKYGK
RLLVVHYEELRHSLVPTLREMVAFLNVSVSEERLLCVENNKEGSFRRRGRRPHDQEPFTP
EMKDLINGYIRTVDQALRDHNWAGLPREYVPR
NT seq 1719 nt   +upstreamnt  +downstreamnt
atggccaaacctttcttcagactccagaagtttctccgcagaacacagttcctgctactc
ttcctcacggccgcctacctgatgaccggcagcctgctgctcctgcagcgggccagagtg
gccctcccacaggccctccgggctcccggcagcctgcaggccttaccagtggccaccgtt
gcactgggtgtgggtctactggacggcaggagccttcgtgatccccacagtagtcctgac
ctactacttgatgtggacacactgaggagtcctctagcccgactaccacctggaatccgc
tggccccggaggaaccgcagctcgctgcggcggcgttggctccaccacctcaccagtgac
ccgcaggggcctcccaccctgagtccggaggcctctggaccagccaaccataatagaggc
aattacctgggatgcttcagtgaggagggccaggagagaactctgaagggagcagtgttt
tacgacttgagaaagatgaccgtgtcacactgccaggatgcctgtgctgagcggtcttat
gtctatgctggcttggaggctggtgcagagtgctactgtgggaataggctgccggccaca
cgtgtcagcctgaaggagtgcaatcaggagtgcaagggagagaaaggctccatgtgcggg
gctgtgcgccggctctctgtgtacagcgtggggctgcagcagccaggctccaagaagcgg
cgcactgccacctaccgagggtgcttcccactgcctgagaatgtcacccacaccttctcc
tcctccatgacacaggccaacatgactgtggagacgtgttctggattttgttcccagaaa
gagtttcctctggccatcctccgaggctgggattgctattgtgcctaccctaccccccag
ttcagcctgcgggatgctgtggatggagcactgtgcagtcaggccccagagacacaaggg
ctacctggctactgtgaggtctaccagacacccgtgcaagacacccggtgcacagacagg
aagttcctgcccgacaagtctaaggtgtttgtggctctgtcgagcttccctggagctggg
aacacatgggcaaggcacctgatcgagcacgccactggcttctacacgggaagctactac
ttcgacggaaccctgtacaacaaggggttcaagggtgagaaggaccattggcggagccgg
cgcaccatctgtgtgaagacgcacgagagtggccggagggagattgagatgtttgactcg
gccatcctgctgatccggaacccctaccggtccctagttgctgaattcaacaggaaatgc
gctggacacttgggctatgcccctgaccgcaattggaagagcaaagaatggccggagttt
gtgaatagctatgcctcctggtggtcctcacatgtcctagactggctcaagtatgggaag
cggctgctggtcgtgcactatgaggagctgcggcacagcctggtgcccacacttcgggag
atggtggctttcctcaatgtgtccgtgagcgaggagcggcttctctgtgtggagaacaac
aaagagggcagcttcaggaggcgtggccggcgccctcatgaccaggagcccttcacccct
gagatgaaggacttgatcaatggctatatcaggacagtggaccaggccttgcgtgaccac
aactgggctgggctgcccagagagtatgtgcccagatga

DBGET integrated database retrieval system