KEGG   Mus musculus (house mouse): 21689
Entry
21689             CDS       T01002                                 
Symbol
Tekt1, MT14
Name
(RefSeq) tektin 1
  KO
K18628  tektin-1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    21689 (Tekt1)
   04812 Cytoskeleton proteins [BR:mmu04812]
    21689 (Tekt1)
Cilium and associated proteins [BR:mmu03037]
 Motile cilia and associated proteins
  Tektins
   21689 (Tekt1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Others
     21689 (Tekt1)
SSDB
Motif
Pfam: Tektin
Other DBs
NCBI-GeneID: 21689
NCBI-ProteinID: NP_001268935
MGI: 1333819
Ensembl: ENSMUSG00000020799
UniProt: Q9DAJ2 Q5NBU4
Position
11:complement(72235543..72253268)
AA seq 418 aa
MAKLLQSPPRFLPEEWYIANKSQYHRAEAQRSQSERLVAESQRLVEEIEKTTRKSQSDVN
KKLEQRLEEVRFWKKELDDKLEQLVNQTDDLLTYKTRLERSLESYKEPLHITEKCLEYRE
KRVGIDLVHDVVEQELQKEADIIHGVMNLLIRTLEESTEQIRLNRSAKYNLEKDLRDKFT
AITIDDVCFSLNNNSPNINFSEKVVRIEPNSVSLEDWLDFSNANVEKADKQLNNSTALKT
LVDQILSQTANDLRRQCEVVDEAFINGLKETKDARNKLADHLAKVMEEIASQEKNIMALE
NAITQQEGPAKVAHTRLETRTHRPNVELCRDIAQYRLIKEIQEINHNVARLKETLAQAQT
QLKALYRRQLALQEEIQVKENTIYIDQVLCMEMRKSIPPRDGDDHGAWEGGIRAEAIC
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggccaagctactgcaatctccacccaggttccttcctgaggagtggtatattgctaac
aaaagccagtaccacagagcagaggcccaaaggtcccaatctgaacgcttggtggcagag
agccagaggcttgtggaagaaattgagaagaccaccaggaagtctcagagcgatgtgaac
aagaaacttgagcagagacttgaggaggtcaggttctggaagaaggagttagatgacaaa
cttgaacagctcgtgaaccagacggatgacctgcttacgtacaagacccgcctggagaga
tccttggagagctacaaggagcccctgcacatcacggagaagtgcttggaatacagggag
aagcgtgtgggcatcgatttggtacacgatgtggtggagcaggagctgcagaaggaggct
gatatcatccacggagtcatgaacctgcttatccgcacgctggaagagtcaacagaacag
atcaggctgaaccgctctgccaagtacaatctggaaaaggatttgagggataagttcacg
gccataactatcgatgacgtctgcttctcactcaacaataactcaccaaatatcaatttt
tctgagaaggttgtgagaatcgagcccaactcagtgagtctggaggactggctggacttc
tccaatgccaatgtggagaaggcagacaaacagctgaacaattcaacggcgctgaagacc
ctggtggaccaaatcctgtcccagacagccaatgacctgcgcagacagtgcgaagtggta
gacgaggcattcataaatgggctgaaggagaccaaggatgccaggaacaagctggctgat
catctggccaaggttatggaagaaattgcttcccaggaaaaaaacatcatggctcttgaa
aatgccatcacgcagcaagaagggccagccaaggtagcacacacacgcctggagaccagg
acgcaccggccgaacgtggagctgtgtcgagatattgcccagtatcggctgatcaaggag
attcaggagatcaaccacaatgttgccaggttaaaggaaaccctggcccaggctcagacg
cagctgaaggccctgtaccgcaggcagctggccctgcaggaggaaatccaggtgaaggag
aacaccatctatatcgaccaggtgctgtgtatggagatgaggaagtccatcccacctcga
gacggcgacgaccatggggcctgggaggggggcatccgcgcagaggccatctgctga

DBGET integrated database retrieval system