KEGG   Mus musculus (house mouse): 217012
Entry
217012            CDS       T01002                                 
Symbol
Unc45b, Cmya4, D230041A13Rik, Unc45
Name
(RefSeq) unc-45 myosin chaperone B
  KO
K21991  protein unc-45
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    217012 (Unc45b)
Chaperones and folding catalysts [BR:mmu03110]
 Other chaperones and cochaperones
  Others
   217012 (Unc45b)
SSDB
Motif
Pfam: UNC45-central Arm TPR_1 TPR_2 HEAT_2 TPR_11 TPR_16 TPR_9 TPR_8 TPR_12 TPR_19 TPR_14
Other DBs
NCBI-GeneID: 217012
NCBI-ProteinID: NP_848795
MGI: 2443377
Ensembl: ENSMUSG00000018845
UniProt: Q8CGY6
Position
11:82802079..82834232
AA seq 929 aa
MAEAEAAQLKEEGNRHFQLQDYKAATKSYSQALKLTKDKALLATLYRNRAACGLKMESYA
QAASDASRAIDINSADIKALYRRCQALEHLGKLDQAFKDVQRCATLEPRNQNFQETLRRL
NTSIQEQLRVQFSTDSRVQTMFEILLNENSEADKREKAANNLIVLGREEAGAERIFQSNG
VALLLQLMNTQRPELLLAAVRTLSGMCSGHRARATAILHAVRIDRICSLMALENEEMSLA
VCNLLQAIIDSLSGEDKREHRGKEEALVLDTKKDLKQITSHLLDMLVSKKVSGQGRDQAL
NLLNKNVPRKDLSIHDNSRTIYVVDNGLRKILKVVGQVPDLPSCLPLTDNTRMLASILIN
KLYDDLRCDPERDHFRKICEEYITSKFDPQDMDKNVNAIQTVSGILQGPFDLGNQLLGMK
GVMEMMVALCGSEREADQLVAVEALIHASTKLSRATFIITNGVTLLKQIYKTTKNEKIKI
RTLVGLCKLGSAGGSDYGLRQFAEGSTEKLAKQCRKWLCNTAIDTRTRRWAVEGLAYLTL
DADVKDDFVQDIPALQAMFELAKTSDKTILYSVANTLVNCTNSYDVKEVVPELVQLAKFS
KQHVPEEHPKDKKDFVDLRVKRLLKAGVISALACMVKADSAILTDQTKELLARVFLALCD
NPKDRGTIVAQGGGKALIPLALEGTDVGKVKAAHGLAKIAAVSNPDIAFPGERVYEVVRP
LVSLLDTQRDGLQNYEALLGLTNLSGRSDKLRQKIFKEKALPDIENYMFENHDQLRQAAT
ECMCNMVLNKEVQERFLADGNDRLKLVVLLCGEDDHKLQNAAAGALAMLTAAHKKLCLKM
TEVTTQWLEILQRLCLHDQLSVQHRGLVIAHNLLSADAELARKLVESELLEILTVVGKQE
PDEKRAAVVQTARECLIKCMDYGFIKPVS
NT seq 2790 nt   +upstreamnt  +downstreamnt
atggcagaggctgaagcggcacagctgaaggaggaggggaaccggcattttcagctccag
gattacaaggcggccaccaagagctacagccaggccctgaagctgaccaaggacaaggct
ctgctagctacactctaccggaatcgggcagcctgcggcctgaaaatggagagctacgcc
caggcagcctcggatgcttccagagccattgacatcaactctgctgacatcaaagcattg
tatcggcgatgccaggcactggagcatcttggcaagttggaccaggcattcaaggatgtg
cagcgctgtgctaccctggagccaaggaaccagaacttccaggagacactgcggaggctc
aacaccagcatccaagagcagctccgtgtgcagttttctacagactccagggtacagacg
atgtttgaaattcttctgaacgaaaacagcgaggctgataagcgagagaaggctgccaac
aacctcattgtcctgggccgtgaagaagcgggtgctgagaggatcttccagagcaatgga
gtggctctgctgctgcagcttatgaacacccagcggcctgagctgctgctagcggctgtg
cggacgctgtctggcatgtgcagtggccacagagctagggccaccgccatcctgcacgca
gtccgcatagacagaatctgcagcctcatggccctggagaatgaagagatgtccctggct
gtctgcaacctgctccaggccatcattgactccctgtctggagaggacaagagagagcat
cgtgggaaggaggaggccttggttctagataccaagaaggacctgaagcagatcaccagc
cacctgctggacatgctggtcagtaagaaagtgtctgggcagggcagagaccaggcactg
aacctgcttaataagaatgtccccaggaaggacctgtccattcatgacaactcacgcacc
atctatgttgtagataacggtctgaggaagatcctgaaggtggtggggcaggttccagac
ctgccctcctgcctacccctgacggacaacacccgcatgctggcctccatcctcatcaac
aagctctatgatgacctgcgctgtgacccagagcgcgaccacttccgcaagatctgtgag
gagtatatcacgagcaaatttgacccccaggacatggacaagaatgtaaatgccatccag
acggtgtccggcatcttgcaggggccctttgacctgggcaatcagctgctgggcatgaaa
ggtgtgatggagatgatggtggctctgtgtggctcggagcgcgaggcagaccagctggtg
gctgtggaggctctcatccacgcctccacgaagctcagccgggccaccttcatcatcacc
aacggagtgacacttcttaagcagatctacaagaccacaaagaatgagaagatcaagatc
cgcacgctggtggggctctgtaaacttggctcagctggaggctccgactatggtctcaga
cagtttgctgaagggtcaacagagaagctagccaagcagtgtcgaaagtggctgtgtaac
accgccatagacacccggacgcggcgctgggcagtggagggcctggcctacctcacgctg
gacgctgacgtgaaggacgactttgtccaggacatccctgctctgcaggccatgtttgag
ttggccaagaccagtgacaagaccatcctctactcagtggccaacaccctggtaaactgc
accaacagctatgatgtcaaggaggtcgtccctgagctggtgcagctggccaagttctcc
aagcaacatgtgccagaggagcaccccaaggacaagaaggacttcgttgacttgcgggtg
aaacgtcttctgaaggcaggtgtcatatctgcactggcctgcatggtgaaggcagacagt
gccatcctcacagaccagaccaaggagctgctggccagggtattcctggcactctgtgac
aatccaaaggaccggggcaccattgtagctcaaggtggtggcaaggccctgatccccctg
gctttggagggcacagatgtgggcaaggtgaaggcagcccatgggctagccaagattgct
gctgtctccaacccggacattgccttccctggggagagggtatatgaggtggtgcggccc
ctcgtgagtctcctggacacacagagggatgggcttcagaactatgaggctctgctggga
ctgactaacctgtctgggcgcagtgacaaactcaggcagaagatcttcaaggagaaggcc
ttgccagacattgaaaactacatgtttgagaaccatgaccagctacggcaggcagccacc
gaatgcatgtgtaacatggtgctcaataaggaggttcaggagaggttcctggccgatggg
aatgatcgtctgaagctggtggtgctgctctgtggggaggatgaccacaaactgcagaac
gcagcagctggagctctagccatgctgaccgcggcacataagaaactgtgcctcaagatg
acggaggtgacaacccagtggctggagatcctacagcggctttgcctgcatgaccagttg
tccgtgcagcaccggggcctggtcattgcccacaacctgctatcagcggatgctgagctg
gcgaggaagctggtggagagcgagctgctggagatcctgactgtggtgggaaagcaggag
ccagatgagaagagagcggctgtggtccagacagcccgggagtgtcttatcaagtgcatg
gattatggcttcatcaagccggtgtcatag

DBGET integrated database retrieval system