KEGG   Mus musculus (house mouse): 217031
Entry
217031            CDS       T01002                                 
Symbol
Tada2a, D030022J10Rik, Tada2l
Name
(RefSeq) transcriptional adaptor 2A
  KO
K11314  transcriptional adapter 2-alpha
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    217031 (Tada2a)
   03036 Chromosome and associated proteins [BR:mmu03036]
    217031 (Tada2a)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     217031 (Tada2a)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    PCAF complex
     217031 (Tada2a)
    SAGA complex
     217031 (Tada2a)
    SLIK complex
     217031 (Tada2a)
    ADA-HAT complex
     217031 (Tada2a)
    HAT-A2 complex
     217031 (Tada2a)
    ATAC complex
     217031 (Tada2a)
SSDB
Motif
Pfam: Myb_DNA-binding SWIRM Myb_DNA-bind_6
Other DBs
NCBI-GeneID: 217031
NCBI-ProteinID: NP_766150
MGI: 2144471
Ensembl: ENSMUSG00000018651
UniProt: Q8CHV6
Structure
Position
11:complement(83969746..84020466)
AA seq 443 aa
MDRLGSFSNDPSDKPPCRGCSSYLTEPYIKCAECGPPPFFLCLQCFTRGFEYKKHQSDHT
YEIMTSDFPVLDPSWTAQEEMALLEAVMDCGFGNWQDVANQMCTKTKEECEKHYMKHFIN
NPLFASTLLNLKQAEAAKAADTAIPFHSADDPPRPAFDSLLSRDMAGYMPARADFIEEFD
NYAEWDLRDIDFVEDDSDILHALKMAVVDIYHSRLKERQRRKKIIRDHGLVNLRKFRLME
RRYPKEVQDLYETMRRFARIVGPVEHDKFIESHALEFELRREIKRLQEYRTAGITNFCSA
RTYDHLKKTREEERLKRTMLSEVLQYIQDSSACQQWLRRQADIDSGLSPSVLMASNSGRR
SAPPLNLTGLPGTEKLNEKEKELCQVVRLVPGAYLEYKSALLNECHKQGGLRLAQARALI
KIDVNKTRKIYDFLIREGYITKA
NT seq 1332 nt   +upstreamnt  +downstreamnt
atggaccgtttgggttcctttagcaatgacccatctgataagccgccctgcagaggctgc
tcctcctacctcacggaaccttacattaaatgtgctgaatgtgggccccctcctttcttc
ctgtgtttacagtgtttcactcgaggatttgagtacaagaaacatcagagtgatcacact
tacgaaataatgacctcagacttccctgttcttgatcccagctggacagcacaagaagaa
atggcccttttagaagctgtaatggactgtggctttggaaattggcaggatgtggctaat
caaatgtgcaccaaaaccaaggaggagtgtgagaagcattacatgaagcatttcatcaat
aaccctctgtttgcatccaccctgctgaacctgaagcaagctgaggcggccaaagctgcc
gacacagccattccatttcactccgcagatgaccctccccggcctgcctttgactcattg
ctgtctcgggacatggcaggctacatgccagcgcgggcagatttcattgaggagtttgac
aattatgcagaatgggacttaagagacattgattttgttgaagacgactcagacatctta
catgctctgaagatggctgtggtggatatctatcattccaggttaaaagagaggcaaaga
agaaaaaagattataagagatcacggattagtcaaccttaggaagttccgattaatggaa
cggcggtatcccaaggaggtccaagacctttatgaaacaatgaggagatttgcaaggatt
gtgggacccgtggagcacgacaagttcattgaaagccatgcattggaatttgaactccga
agggaaatcaagaggctccaagaatataggacagcaggcattaccaatttttgtagtgcc
aggacatatgatcacctgaagaagacacgcgaggaggagcgccttaaacgcaccatgctc
tcagaagttctccagtacatccaggacagcagtgcgtgccagcagtggctccgccggcag
gctgacattgattctgggctgagtccttctgttctgatggcttctaactcaggaaggcga
agtgcaccaccattgaacctcacgggtctccctggtacagagaaactcaatgaaaaggaa
aaggagctctgtcaggtggtgaggttggtacctggagcctacttggaatataagtctgct
ctattgaacgagtgtcacaagcaaggaggcttgagactggcacaagcaagggcactcatc
aagatagacgtgaacaaaacccggaaaatctatgacttcctcatccgagaagggtacatc
acgaaagcctga

DBGET integrated database retrieval system