KEGG   Mus musculus (mouse): 217039
Entry
217039            CDS       T01002                                 

Gene name
Ggnbp2, AI451896, C75939, D330017P12Rik, DIF-3, Zfp403
Definition
(RefSeq) gametogenetin binding protein 2
Organism
mmu  Mus musculus (mouse)
SSDB
Other DBs
NCBI-GeneID: 217039
NCBI-ProteinID: NP_694784
MGI: 2387356
Ensembl: ENSMUSG00000020530
Vega: OTTMUSG00000001025
UniProt: Q5SV77
Position
11; 11 C
AA seq 698 aa
MARLVAVCRDGEEEFPFERRQIPLYIDDTLTMVMEFPDNVLNLDGHQNNGAQLKQFIQRH
SMLKQQDLSIAMVVTSREVLSALSQLVPCVGCRRSVERLFSQLVESGNPALEPLTVGPKG
VLSLTRSCMTDAKKLYTLFYVHGSKLNDMIDAIPKSKKNKRCQLHSLDTHKPKPLGGCWM
DVWELMSQECRDEVVLIDSSCLLETLETYLRKHRFCTDCKNKVLRAYNILIGELDCSKEK
GYCAALYEGLRCCPHERHIHVCCETDFIAHLLGRAEPEFAGGYERRERHAKTIDIAQEEV
LTCLGIHLYERLHRIWQKLRAEEQTWQMLFYLGVDALRKSFEMTVEKVQGISRLEQLCEE
FSEEERVRELKQEKKRQKRKNRRKNKCVCDTPASLHTADEKAVSREKETDFIENSCNACG
SAEDGETCVEVMVTSENTSCTCPSSGNLLGSPKIKKGMSPHCNGSDCGYSSSMEGSETGS
REGSDVACTEGICNHDEHGEDSCVHHCEDKEDDGDSCVECWANSEENNIKGKNKKKKKKS
KMLKCDEHIQKLGSCITDPGNRETSGNTMHTVFHRDKTKDAHPESCCSTEKGGQPLPWFE
HRKSVPQFTEPTEMSFGPDSGKGAKSLVELLDESECTSDEEIFISQDEIQSFMANNQSFY
SNREQYRQHLKEKFNKYCRLNDHKRPVCSGWLTTAGAN
NT seq 2097 nt   +upstreamnt  +downstreamnt
atggcgcgactggtggcagtgtgcagggacggggaggaggagttccccttcgagaggagg
cagatccccctctacatagacgacaccctgacgatggtgatggaatttcctgacaatgtt
ttaaatcttgatgggcatcagaataatggtgcacaactaaagcagtttattcagcgacac
agtatgcttaagcaacaagatttaagtattgccatggtggtaacatcacgcgaagtcttg
agtgcactttctcagcttgtcccatgtgttggttgtcgtcgaagtgtggaacgcctcttt
tctcaacttgtagagtctggaaatcctgcccttgaacccctgacagtagggcccaaggga
gtactatctctgactcggagctgcatgactgatgcaaaaaagctttatacattattttat
gtacatgggtccaaactaaatgatatgatagatgctattccaaaaagtaagaagaacaag
agatgtcagttacactctttagatacacacaaacctaaacctctgggaggatgttggatg
gatgtttgggaactcatgtcccaggaatgcagggatgaagtagttttaattgactctagt
tgtcttttagaaacactagaaacatatcttcgaaagcacaggttttgcactgattgcaaa
aataaagtcctccgagcatacaatatcctcattggtgaacttgactgcagcaaagagaag
ggctactgtgctgccctgtatgaaggattgcggtgctgtccacatgagcgacacatacat
gtttgctgtgaaacagacttcattgcacatctcttgggtcgtgctgagccagagttcgca
ggagggtatgagcgaagagaaagacatgctaagacaatagatatagctcaagaagaagtt
ttgacctgcttggggattcatctttatgaacgactgcatcggatctggcaaaaactacgg
gctgaagagcagacgtggcagatgctcttttatctcggtgttgacgctttacgtaagagc
tttgagatgactgtggaaaaagtgcagggtattagccgcttggaacaactttgtgaggaa
ttttcagaggaagaacgagttagagaactcaagcaagaaaagaaacgccaaaaacggaag
aacagacgaaaaaataagtgtgtgtgtgacactcctgcttccttacacaccgcagacgag
aaagcagtgagccgagagaaggaaacagacttcattgaaaacagctgcaacgcctgtggc
agtgctgaagatggcgagacttgtgtagaagtaatggttaccagtgaaaacacatcatgt
acctgtccgagcagtggcaatcttttggggtcccctaaaataaagaaaggtatgtctcca
cactgtaatggtagtgactgtggatattcatctagcatggaaggaagtgaaacaggttct
cgagaaggttcagatgttgcctgcaccgagggaatttgtaaccatgatgaacatggtgaa
gattcctgtgttcaccactgtgaagacaaagaagatgatggtgacagttgtgttgaatgt
tgggcaaattctgaagaaaataacataaaaggaaaaaataaaaagaagaaaaagaaaagc
aagatgttgaaatgcgatgaacatatccaaaaacttggaagctgtattacagatccaggt
aatcgagagacctcaggaaacactatgcacacagtgtttcaccgtgacaagaccaaagat
gcacatcctgagagttgttgcagcactgagaagggtgggcagccattgccttggtttgag
cataggaaaagcgtaccacagttcacagaacctacagaaatgtcatttggtcctgactct
ggaaaaggtgccaagagcttagttgaacttcttgatgagtctgaatgtacttcagatgag
gaaatctttatctcacaagatgaaatacagtcatttatggctaataaccagtctttctac
agcaatagagaacaataccgacagcatctgaaggagaaatttaataaatactgccgctta
aatgatcacaagaggcccgtttgtagtggctggctgacaacggctggagcaaattaa

DBGET integrated database retrieval system