KEGG   Mus musculus (mouse): 217194
Entry
217194            CDS       T01002                                 

Gene name
Klhl11, BC011167
Definition
(RefSeq) kelch-like 11
  KO
K10449  kelch-like protein 11
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    217194 (Klhl11)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     217194 (Klhl11)
SSDB
Motif
Pfam: BACK BTB Kelch_6 Kelch_1 Kelch_4 Kelch_2 Kelch_3 DUF3342
Other DBs
NCBI-GeneID: 217194
NCBI-ProteinID: NP_766153
MGI: 2388648
Ensembl: ENSMUSG00000048732
Vega: OTTMUSG00000006269
UniProt: Q8CE33 Q14DU1
Position
11; 11 D
AA seq 709 aa
MAAAVAAAAAAAAAAASFQVLEMESMETAVAGSASLAAEVRGSGTVDFVTGAGISTLVDT
GGSDPGPEAEDFECSTHCSELSWRQNEQRRQGLFCDITLCFGGAGGREFRAHRSVLAAAT
EYFTPLLSGQFSESRSGRVEMRKWSSEPGPEPDTVEAVIEYMYTGRIRVSTGSVHEVLEL
ADRFLLIRLKEFCGEFLKKKLHLSNCVAIHSLAHMYTLSQLALKAADMIRRNFYKVIQDE
EFYTLPFHLIRDWLSDLEITVDSEEVLFETVLKWVQRNAEERERYFEELFKLLRLSQMKP
TYLTRHVKPERLVANNEVCVKLVAEAVERHALRAENIQSGTLQQPTSQVSLLPRYGQNMD
VIMVIGGVSEGGDYLSECVGYFVDEDRWVNLPHIHNHLDGHAVAITESYVYVAGSMEPGF
AKTVERYNPNLNTWEHVCSLMTRKHSFGLTEVKGKLYSIGGHGNFSPGFKDVTVYNPELD
KWHNLESAPKILRDVKALAIEDRFVYIAARTPVDRDTEDGLKAVITCYDTETRQWQDVES
LPLIDNYCFFQMSVVNSNFYQTASCCPKSYSLENEEAVRKIAGQVSDEILESLPPEVLSI
EGAAICYYRDDVFIIGGWKNSDDIDKQYRKEAYRYCAERKRWMLLPPMPQPRCRATACHV
RIPYRYLHGTQRYPMPQNLMWQKDRIRQMQEIHRHALNMRRVPSSQIEC
NT seq 2130 nt   +upstreamnt  +downstreamnt
atggcggcggctgtggcggcggcagctgccgctgcggccgcggctgcatcttttcaagtg
ctggagatggagagcatggagactgccgtcgccggttccgcgagcctggccgctgaggtc
cgaggcagtggcacggtagacttcgtgaccggggccggcatctctaccctcgtcgacacg
ggcgggagcgatccgggcccagaggccgaggacttcgagtgcagcactcactgctccgag
ttgtcctggcggcagaacgagcagcggcgtcaaggcctgttctgcgacatcaccctgtgc
ttcggcggggccggaggtcgcgagttccgtgcccaccgctcggtgctggccgctgccacc
gagtacttcacgcccttactctcgggtcagttttcggaatcgcgctcgggccgggtggag
atgcgcaagtggagctcagagcccggacccgaacctgacacggtggaagccgttatcgag
tacatgtacaccggccgcatccgagtgagcaccggcagcgtgcacgaggtgctggagctg
gccgacagattcttattaattcgtttaaaagaattctgtggagaatttctcaagaaaaaa
cttcatctctcgaattgtgtggccattcatagcttagcccacatgtataccctgagccag
cttgctctgaaagctgcagatatgatacggagaaatttctataaagtcattcaggatgag
gaattttacactttacctttccatctcattcgggactggctttcggacttggaaatcact
gtggattctgaagaggttctttttgaaacagttttgaagtgggttcagagaaatgcagaa
gagagagagagatactttgaagagctttttaaattgctcagattgtcccagatgaaaccc
acctaccttacacggcatgtcaaaccagagcggctagtggccaataatgaagtttgtgtc
aagctggtggcagaagcagtggagaggcatgcgctcagagcagagaatatacagtctggc
acattgcagcagcccacttcacaagtctcactgttacctcgctatggacaaaacatggac
gtaatcatggttatcggaggagtgtcggaaggaggagactacttaagtgaatgtgtggga
tattttgttgatgaggataggtgggtcaatctgccccacattcataaccaccttgatgga
catgccgtcgcaattacagagtcctacgtgtatgttgctggctccatggaaccagggttt
gctaaaactgtggaaagatacaacccaaacctgaatacatgggaacatgtttgtagtctg
atgaccagaaagcactcttttgggctaacagaagtcaaagggaagctgtatagcattgga
ggacacggcaattttagccctggctttaaagacgtgactgtttacaatcccgagcttgat
aaatggcacaacttagagtcagcaccaaagattctgcgagatgtcaaagcattagccatt
gaggaccggtttgtgtacattgctgcccgcacgcccgtggaccgggacactgaggatgga
ctgaaggctgtaattacttgctatgatacagagactcgacagtggcaagatgtggaatct
ttaccgcttattgacaattactgttttttccagatgtctgtggtcaattcaaacttttat
cagacagcatcatgctgtcccaagagttactccttagaaaatgaagaagcagtaagaaaa
attgccggtcaggtgtctgatgagatccttgaaagcttgcctccagaagtcctaagcatc
gaaggagcagccatttgctattacagagatgatgtcttcattattggaggctggaaaaac
agtgatgatattgacaaacagtacaggaaagaggcctaccgatactgtgctgagagaaag
aggtggatgctccttcctccaatgcctcagccccgctgcagggccactgcttgccatgtc
aggatcccttaccggtacttacatggcacacagagataccccatgcctcaaaatttaatg
tggcagaaggaccgcatccgacagatgcaagagatacatcggcacgccctgaacatgcgg
agagtgccaagttcccagattgaatgctga

DBGET integrated database retrieval system