KEGG   Mus musculus (mouse): 217201
Entry
217201            CDS       T01002                                 

Symbol
Rundc1, AW125546, D930024B17
Name
(RefSeq) RUN domain containing 1
  KO
K24786  RUN domain-containing protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    217201 (Rundc1)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Other domain-containing proteins
  RUN domain-containing proteins
   217201 (Rundc1)
SSDB
Motif
Pfam: RUN DUF1192 Phage_int_SAM_2
Other DBs
NCBI-GeneID: 217201
NCBI-ProteinID: NP_766154
MGI: 2144506
Ensembl: ENSMUSG00000035007
Vega: OTTMUSG00000002871
UniProt: Q0VDN7
Position
11:101315910..101326492
AA seq 615 aa
MATVEVATELGTVVTAVGPKAKDEEEEEEEEESLPPCETVRWAPVGAVAEAGPGAATFSE
AAAAEEPGAAPGSPSDATVRTLRRLEAERRQLDSALLALSSHFAQVQFRLRQVVRGAPAE
QQRLLRELEDFAFRGCPHVLGYEGLADPCGGDESDVLPGDRPRVRGEDQSEQEKRERLET
QREKQKELILQLKTQLDDLETFAYQEGSYDSLPQSVVLERQRVIIDELIKKLDMNLNEDI
SSLSTEELRQRVDAAVAQIVNPVRVKEQLVEQLKTQIRDLEMFISFIQDEVGSPLQTGGH
CECQASGKVGIGSTRVGGSTLPPGPGKAKAEDAKRARETGLHLMRRALAVLQIFTVSQLG
CATGQIPQTLWQRSQADRDYSHLLKRLEVSVDRVKQLALRHQPHDHVITSANLQDLSLGG
KDELTTVVRKELTVAVRDLLAHGLYASSSGMSLVMAPLACLLPVFSSAPETMHPWELFVK
YYHAKNGRAYVESPARKLSQSFALPIMGDTAVTPKQSLLTAIHLVLTEHDPFKRSADSEL
KALVCMALNEQRLVSWVNLICKSGSLIEPHYQPWSYMAHTGFESALNLLSRLSSLKFSLP
VDLAVRQLKNIKDAF
NT seq 1848 nt   +upstreamnt  +downstreamnt
atggcgacggtggaagtggctacggagctaggaactgtggtgaccgctgtcgggcctaag
gcgaaggacgaggaagaagaagaagaggaggaggagtcgctgccaccatgcgagactgtg
cgctgggctcccgtgggggcagtggccgaggccggtcctggggcggcgacgttctcggag
gcggcggcagccgaagagcctggagcggctccgggctctccatccgacgcgactgtccgc
acgctgaggcggctggaagccgagcggcggcagctggattcggccctgctcgcgctgtcc
tcgcacttcgcgcaggtgcagttccgtctgcgccaggtagtgcgcggggcgccggcggag
cagcagcgtctcctgcgcgagctcgaagactttgccttccgcggctgtcctcacgtcctg
ggttacgaggggctggcagacccttgtggcggtgacgaaagcgatgtgctgccgggggac
cggccacgggtgcggggtgaggaccagagcgaacaggaaaaacgggagcgcctggaaacc
cagagggagaagcagaaagaactgattctgcagctgaagacccagcttgatgacctggag
acgtttgcctatcaggagggtagttatgactccctgccgcagtccgtggtcttggaaaga
cagcgggtgatcatcgatgagttaataaagaaactggacatgaatctgaatgaggacatc
agttccctttccactgaggagcttcgtcaacgtgtggacgcagcagtggctcagattgtc
aacccagtgcgggtgaaagagcagctggtggagcagctgaaaacccagatccgggacctt
gagatgttcatcagcttcatccaagatgaagtgggaagccccctgcagacaggtggacac
tgtgagtgccaagccagcgggaaggtgggaatcggctccaccagggtgggtggcagtaca
ctgcccccaggacccggcaaagcaaaggcagaagatgccaagagagcccgggagacgggg
ctgcacctgatgcggcgagcgctggctgtgctccagatcttcactgttagccagctgggc
tgtgccacgggccagatccctcaaaccttgtggcagaggagccaggcagacagagactac
tcccacttactgaaaagactggaagtatcggtcgacagagtaaagcagctagccttgaga
catcagccacatgaccacgtcatcacttcggccaacctccaggacctctctctgggaggc
aaggatgagctgaccacggttgtgcggaaggagctgacagtggctgtgagggacctgctg
gcccatggactgtatgcctcctcctctgggatgagccttgtcatggccccccttgcttgc
ttgttgccagttttctcctcagcccccgagaccatgcacccatgggagctctttgtaaag
tactaccatgccaagaatggccgtgcatatgtggaatccccggcccggaagctctcacag
tcctttgctctgcctataatgggtgacactgctgtgacccccaaacagagccttctgaca
gccatccacctggtgctgacagagcatgaccctttcaagcgcagcgctgactcagaactg
aaggcgttggtgtgcatggcactgaatgagcagcgcctggtgtcctgggtgaacctcatc
tgcaagtcagggtccctcatcgagccccattaccagccctggagctacatggcccacaca
ggttttgagagtgccctcaacctgctcagccgccttagcagcctcaagttcagccttcct
gtagacttggccgtgcgccagctcaagaacatcaaagatgccttttga

DBGET integrated database retrieval system