KEGG   Mus musculus (mouse): 217212
Entry
217212            CDS       T01002                                 

Symbol
Pyy
Name
(RefSeq) peptide YY
  KO
K05233  peptide YY
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    217212 (Pyy)
SSDB
Motif
Pfam: Hormone_3
Other DBs
NCBI-GeneID: 217212
NCBI-ProteinID: NP_663410
MGI: 99924
Ensembl: ENSMUSG00000017311
Vega: OTTMUSG00000002320
UniProt: Q9EPS2 Q3V334
Position
11; 11 D
AA seq 98 aa
MVAVRRPWPVTVAMLLILLACLGALVDAYPAKPEAPGEDASPEELSRYYASLRHYLNLVT
RQRYGKRDVPAALFSKLLFTDDSDSENLPFRPEGLDQW
NT seq 297 nt   +upstreamnt  +downstreamnt
atggtggcggtgcgcaggccttggcccgtcacggtcgcaatgctgctaatcctgctcgcc
tgtctgggagccctggtggacgcctaccctgccaaaccagaggctcccggcgaagacgcc
tccccggaggagctgagccgctactacgcctccctgcgccactacctcaacctggtcacc
cggcagcggtatggaaaaagagatgtccccgcagctctgttctccaaactgctcttcaca
gacgacagcgacagcgagaacctccccttcaggccagaaggtttggaccagtggtga

DBGET integrated database retrieval system