KEGG   Mus musculus (mouse): 217219
Entry
217219            CDS       T01002                                 

Gene name
Fam171a2
Definition
(RefSeq) family with sequence similarity 171, member A2
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: UPF0560 Adeno_E3_CR2
Other DBs
NCBI-GeneID: 217219
NCBI-ProteinID: NP_954670
MGI: 2448496
Ensembl: ENSMUSG00000034685
Vega: OTTMUSG00000002855
UniProt: A2A699
Position
11; 11 D
AA seq 822 aa
MPPPSGPGVLARLLPLLGLLLGGASRAPGKSPPEPPSPQEILIKVQVYVSGELVPLARAS
VDVFGNRTLLAAGTTDSEGVATLPLSYRLGTWVLVTAARPGFLTNSVPWRVDKLPLYASV
SLYLLPERPATLILYEDLVHILLGSPGARSQPWVQFQRRAARLPVSSTYSQLWASLTPAS
TQQEMRAFPAFLGTEASSSGNGSWLELIPLAAVSVHLLTGNGTEVPLSGPIHLSLPVPSE
PRALAVGTSIPAWRFDPKSGLWVRNGTGVIRKEGRQLYWTFVSPQLGYWVAAMASPTSGL
VTITSGIQDIGTYHTIFLLTILAALALLVLILLCLLIYYCRRRCLKPRQQHRKLQLSGPS
DNKRDQATSMSQLHLICGGPLEPTSSGDPEAPPPGSLHSAFSSSRDLASSRDDFFRAKPR
SASRPAAEPPGARTVEGAGLKSARSVEGPGGLEPSLDEYRRGPAGAAAFLHEPPSPPPSF
DHYLGHKGAAESKTPDFLLSQSVDQLARPPSLSQPGQLIFCGSIDHLKDNVYRNVMPTLV
IPAHYVRLGGEAGAAGVGDEATPPEGSAAGPARPFPQPDPQRPLMQGHAGAGGDSGGGEG
WGGGRSAPVSGSVTIPVLFNESTMAQLNGELQALTEKKLLELGVKPHPRAWFVSLDGRSN
SQVRHSYIDLQAGSGGRSTDASLDSGVDVHEARPARRRLPREERERAQLPAPPPPAPPRL
ALSEDTEPSSSESRTGLCSPEDNSLTPLLDEVVAPEGRAATVPRGRGRSRGDSSRSSASE
LRRDSLTSPEDELGAEVGDEAGDKKSPWQRREERPLMVFNVK
NT seq 2469 nt   +upstreamnt  +downstreamnt
atgccgccgccgagtggccccggcgtcctcgcgcggctgctgccgctgctggggctgctg
ctcggcggcgcctcccgggctcccggcaagtctccgccggagccccccagcccgcaggag
atcctgatcaaggtacaggtatatgtgagcggggagctggtgcccctggccagggcctca
gtagacgtctttgggaaccgcactcttctggctgctggtactacggactcagagggcgtg
gccacactacccctcagttaccgcctgggtacctgggtcttggtcactgctgcccgcccc
ggtttcctcaccaactcagtgccctggcgtgttgacaagctgccgttgtacgcatccgtc
agcctctacctgctcccagagaggccagccaccctcatcctctatgaggaccttgtgcac
atcctcctaggctcgccaggtgcccgctcccagccctgggtgcagttccagcgtagagct
gcccgcctgcctgtcagttccacctacagccagctttgggcttcgctcacaccggccagc
acccagcaggaaatgcgggctttccctgccttcctggggaccgaggcctccagctcaggc
aatggctcctggctggagctgataccactggctgctgtgagcgtccacctgctaacaggc
aatgggacagaggtgcctctctcaggccccattcacctgtccctgccagtgccctcagag
cctcgtgcccttgctgtgggcaccagcattccagcctggaggtttgaccccaagagtgga
ctgtgggtacgaaatggcactggtgtgattcggaaggaaggccgacagctctactggact
tttgtctccccgcagctagggtactgggtagctgccatggcctcccctacatctgggctg
gttaccatcacctcaggcattcaggacattggcacctaccacacaatcttcctgctgacg
atcctggctgccctggcgctgctggtgctcattctgctgtgtctactgatctactactgc
agaagacgctgcttgaagcctagacaacagcaccgcaagctgcagctctccggcccctcg
gacaacaaacgagatcaggctacgtcgatgtctcaactccatctcatctgcgggggaccc
ctggagcctacgtcgtcgggagaccccgaggcccctcccccaggctccctacactcggcc
ttctccagctcccgagacttagcatcctcgcgggatgacttcttccgtgccaaaccgcgc
tccgccagccgaccggccgccgagcctcctggtgcccgcaccgttgagggtgccgggctc
aagagcgcccgctccgtcgagggtcctggcgggctggagcccagcctggacgaataccgg
cggggtccagccggggccgcggccttcctgcatgagcctccctcgccgccgccatccttc
gaccattatctgggccacaagggggcggccgagagcaagacccccgactttctgctgtca
cagtcggtagaccagctggcgcggccgccgtccctcagccaaccgggccagctcattttc
tgcggttccatcgaccacctcaaggacaacgtgtaccgcaatgtcatgcccaccctggtg
atccccgcacactatgtgcgcctgggcggagaggcgggcgccgcgggagtgggcgacgaa
gccaccccgccggagggctcggccgccggccccgcgcgccccttccctcaacccgacccc
cagcgccccctgatgcagggccacgcgggtgcgggaggcgacagcggtggcggcgagggc
tggggcggcgggcgctccgcaccggtcagcggctcggtcaccattccggtgctgttcaac
gagtccaccatggcgcagctcaacggcgagctgcaggctctaaccgagaagaagctgctg
gaactgggagtgaagcctcacccgcgcgcctggttcgtatccctggacggacgttccaat
tcacaagtgcgccactcctacatcgacctgcaggcgggcagcggcggccgcagcaccgat
gccagcctggactcaggcgtcgacgtgcacgaggctcgacctgcgcgccgccggctcccg
agggaagagcgggagcgcgcgcagctgcccgcgccgccgccgcccgcgcccccgcgcctg
gcgctcagcgaagacacagagcccagcagcagcgagagccgcaccggcctctgctcgccg
gaggacaactcgctaacgcccctgctggacgaggtggtggcacccgaaggccgggcagcc
acggtacccaggggtcggggccgcagccgtggggacagttcccgcagcagcgccagtgag
ctgcggcgcgattcgctcaccagcccggaggacgagctgggggcggaggtgggcgacgag
gctggcgacaagaagagcccgtggcagcggcgggaggagcggccgctaatggtgttcaac
gtcaagtag

DBGET integrated database retrieval system