KEGG   Mus musculus (mouse): 217232
Entry
217232            CDS       T01002                                 

Gene name
Cdc27, AI452358, AP, APC3, BC023187
Definition
(RefSeq) cell division cycle 27
  KO
K03350  anaphase-promoting complex subunit 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04120  Ubiquitin mediated proteolysis
mmu04914  Progesterone-mediated oocyte maturation
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    217232 (Cdc27)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    217232 (Cdc27)
   04114 Oocyte meiosis
    217232 (Cdc27)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    217232 (Cdc27)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    217232 (Cdc27)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    217232 (Cdc27)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    217232 (Cdc27)
   03036 Chromosome and associated proteins [BR:mmu03036]
    217232 (Cdc27)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     217232 (Cdc27)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     217232 (Cdc27)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    217232 (Cdc27)
SSDB
Motif
Pfam: TPR_1 TPR_2 ANAPC3 TPR_8 TPR_12 TPR_11 TPR_16 TPR_17 TPR_19 TPR_14 TPR_6 TPR_9 ChAPs PPTA TPR_MalT TPR_20 Cas_Cas02710 DUF2225
Other DBs
NCBI-GeneID: 217232
NCBI-ProteinID: NP_663411
MGI: 102685
Ensembl: ENSMUSG00000020687
Vega: OTTMUSG00000003148
UniProt: A2A6Q5 Q3TTW1 Q8BYJ1
Position
11 E1; 11 67.79 cM
AA seq 825 aa
MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRL
LKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDLVTEFGDSACFTLSL
LGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKLTSLQNFSSCL
PNTCTTLVSNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSTVI
SPDNVPLGPGTAILSKQVQNKPKTGRSLLGGPTALSPLTPSFGILPLETPSPGDGSYLQN
YTNTPSVIDVAPTGAPTKKSVARMGQTGTKSVFSQSGNSREVTPVLVAQTQSSGPQTSTT
PQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGLT
QPSINDSLEITKLDSSIISEGKITTVTPQIQAFNLQKAAAEGLMSLLREMGKGYLALCSY
NCKEAINILSHLPSHHYSTGWVLCQIGRAYFELSEYMQAERIFSEVRRIESFRVEGMEIY
STTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPN
YAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQ
KALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKY
KSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAI
DKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF
NT seq 2478 nt   +upstreamnt  +downstreamnt
atgacggtgctgcaggaacctgtccaggctgctatatggcaagcgctaaaccactatgct
taccgagatgcagttttcctcgcagaacgactatatgcagaagtacattcagaagaagcc
ttgtttttactggcaacctgttactaccgctcaggaaaggcttataaagcatatagactc
ttgaaaggacacagttgtaccaccccacagtgtaaatacctgcttgcaaaatgttgtgtt
gacctcagcaagcttgcagaaggggaacagatcttatctggtggagtgtttaataagcag
aaaagccatgacgaccttgtcactgagtttggagattcagcttgcttcactctttccttg
ttgggacatgtgtattgcaagacagatcggcttgccaaagggtcagaatgttaccaaaag
agccttagtttaaatcctttcctctggtctccctttgaatcgttatgtgaaataggtgag
aagccagatcctgaccaaacatttaaattaacatctctacagaattttagcagttgtctt
cccaacacttgtacaactctagtatctaatcacagtttatctcacagacagcctgagaca
gtccttacagaaacaccccaagacacaattgaattaaacagactgaatttagaatcttcc
aattcaaagtactccttgaatacagattcctccgtgtcttacattgattcaactgtaatt
tcaccagataacgtcccccttggacctggtactgccatattatctaaacaggttcaaaat
aaaccaaaaactggtcgaagtttattaggaggaccaactgctcttagcccattaacccca
agttttgggattttgccattagaaaccccaagtcctggagatggatcctatttacaaaac
tacactaatacaccttctgtaattgatgtggcacccaccggagcacctacaaaaaagtct
gttgcaagaatgggccaaactggaacaaagtctgtcttctcacagagtggaaatagtcga
gaggtcacaccagtacttgttgcacaaacacaaagttctggcccacaaacaagtacaaca
cctcaggtattgagccccactatcacatctcccccaaacgcattgcctcggagaagttcc
cgccttttcactagtgacagttctacaaccaaggagaatagcaaaaagttaaaaatgaag
tttccacctaaaatccctaacagaaaaacaaaaagtaaaactaataaaggaggactaact
cagcccagcataaacgatagtctggaaattacaaaactggactcctctatcatttcagaa
gggaaaataaccacagtcacacctcagatccaggcatttaacctacaaaaggcagcagca
gaaggtttgatgagccttcttcgtgaaatgggaaaaggttatttagctttgtgttcatac
aactgcaaagaagctatcaatattttgagccatctaccttctcatcactacagtactggt
tgggtcctatgccagattggacgggcttattttgaactttcagaatacatgcaggctgaa
agaatattctcagaggttagaaggattgagagtttcagagttgaaggaatggagatctac
tctacaacactctggcatcttcagaaagacgttgctctttcagttctttcaaaagattta
acagacatggataagaattcaccagaggcctggtgtgctgcagggaattgtttcagtcta
caacgagagcatgatatagcaattaaattcttccaaagagctatccaggtcgatccaaat
tacgcttacgcctatactctattaggacatgagtttgtgttaactgaagaactagataaa
gcattagcatgttttcgaaatgctataagagtaaatcccagacattacaatgcatggtat
ggtttaggaatgatttattacaagcaagagaagttcagcctcgcagaaatgcatttccag
aaagcacttgatatcaaccctcagagttcagttttactttgccacattggagtagttcag
catgcactaaagaagtctgagaaggctttggataccctaaacaaagccattgttatcgat
cccaagaaccctctatgcaaatttcacagagcctcggttttatttgcaaatgaaaaatac
aagtctgctttacaagaactcgaggaactgaagcagattgtccccaaagagtccctcgtt
tacttcctaataggaaaggtttacaagaagttgggtcaaactcatctcgccttgatgaat
ttctcttgggctatggatttagatcctaaaggagccaataatcagattaaagaggcaatt
gacaagcgctaccttccagatgatgaggagccaataacccaggaggaacagatcatgggg
acagatgaatcccaggagagcagcatgacagatgcagatgacacacaacttcatgcggcg
gaaagtgacgaattttaa

DBGET integrated database retrieval system